KEGG   Mycobacterium sp. VKM Ac-1817D: G155_21765Help
Entry
G155_21765        CDS       T03634                                 

Definition
(GenBank) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:myv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    G155_21765
Enzymes [BR:myv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     G155_21765
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     G155_21765
    1.1.1.-  
     G155_21765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc Pyr_redox_3 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AIY47748
UniProt: A0A0A1FSV1
Position
complement(4564252..4565307)
Genome map
AA seq 351 aa AA seqDB search
MRAAVYYGPNKVEVADVPEPDPTPGTVKIKVGFNGICGTDLHEYYAGPIFVPTEPHPLTG
RQLPLTMGHEFSGTITELGAGVTGYAVGDRVAVEPIYRCGHCAPCRAGTYNICRQIGFHG
LMSDGGMAEYTVVPADMLHRLPDNVSLELGALVEPMSVAYHAATLGEVGPLHTAVIFGAG
PIGIGVWFALRGKGLDEVFVVEPSETRRGAIEDLGARTLDPGAIDVPAFIADRTDGRGAD
AAFDAAGVAPAIAAATACVGARKPTISVAIYEKPLATPLLNLVMNESRIQGSLCYTSADF
EAVIDLMAQGRYETRGWVTPIGIDDVIDEGFEALHAGKKMKVLVNPNGGPS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagccgtgtactacgggccgaacaaggtcgaggtcgccgatgtcccagagccc
gacccgactcccggcaccgtcaagatcaaagtcggattcaacggtatctgtggcactgac
ctgcatgaatactatgccggaccgatcttcgtcccgaccgagccgcatccgctgaccgga
agacagctgccgctgacgatgggccacgagttctcggggaccatcaccgaactgggtgcc
ggtgtcacggggtatgcggtcggtgaccgggtggcggtcgagcccatctaccggtgcgga
cattgcgcgccgtgccgcgcaggcacgtacaacatctgtcggcagatcggtttccacggg
ctgatgtccgacggcggtatggccgagtacaccgtcgtcccggccgacatgctgcaccga
ttgcctgacaacgtgtctctggagttgggcgcgctggtggaaccgatgtcggtggcctat
cacgccgcgaccttgggagaggtcggtccgttgcacaccgcggtgatcttcggcgccggg
ccgatcggcatcggcgtctggtttgcgctgcgcggcaaagggctcgacgaggtgttcgtc
gtggaaccgtccgagacgcggcgcggcgcgatcgaggacctcggggccaggaccctggat
ccgggagccatcgatgttcccgccttcatcgccgaccgcaccgacggccggggtgccgac
gccgcgttcgacgctgccggggtggcgccggcgattgccgcggccacggcgtgtgtcggt
gcgcgcaagccgacgatcagtgtcgcgatctatgaaaagcctctggccacaccactgctc
aacctcgtgatgaacgagtcccggatccaggggtcgctgtgctacacctcggcggacttc
gaggcggtcatcgatctgatggcgcaggggcgctacgaaacacggggctgggtgacgccg
atcggaatcgacgacgtgatcgacgagggcttcgaggccctgcatgccggaaagaagatg
aaggtgctggtcaacccgaacggcggtccgtcgtga

DBGET integrated database retrieval system