KEGG   Mycobacterium sp. VKM Ac-1817D: G155_23470Help
Entry
G155_23470        CDS       T03634                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:myv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    G155_23470
Enzymes [BR:myv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     G155_23470
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     G155_23470
    1.1.1.-  
     G155_23470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AIY48013
UniProt: A0A0A1FTG4
Position
complement(4917057..4918109)
Genome map
AA seq 350 aa AA seqDB search
MKAAQWYGKEDLRVEEVSEPTPGPGQVKLRNAYSGICGSDLHYYFFPESLPFDPNKPHPL
TGAALPQILGHEFAGTVVEVGEGVTGVKIGDRAAVYPLTAYCGECAACRRGLHFSCPLMG
SVGANAPGGGLSEYTAVDASALHLLPDNVDLRLGALVEPMAVGWHAVARSGVEPGGTALI
AGAGPIGIGAWFAFKARGVEKVLVSEPSADRRAIVARLGATVVDPVNEDLGAVIVEFTGG
AGVDAAVDAAGAGAAITSALAGLVAGGRIVVAALHEHPMDFQPTMLMMGETEIVGAVGYE
PEEFDAVIAAMANGVYDTTGWVEERPLAGIVDALHTLRSGAGAKILIKTD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcgcagtggtatggcaaggaagacctccgtgtcgaggaggtttcagaaccc
acgcccgggccgggacaggtgaaattgcgtaatgcttattcgggcatctgcggctcggac
ctgcactactacttctttcccgaatccctacctttcgaccccaacaagccgcacccactt
accggcgctgcattgccgcagatcctgggtcacgagttcgccggcaccgtcgtcgaggtg
ggtgagggcgtcacgggcgtgaagattggtgatcgtgccgcggtatacccactgactgcc
tactgcggtgaatgtgcggcgtgccgcaggggactgcacttctcgtgcccgttgatgggc
tcggtcggcgcaaacgcgcccggcggtggtctgtccgaatacacggcagtcgacgcgtcg
gcgctgcaccttttgcccgacaacgtcgatctgcgcctgggtgcgctcgtcgagccgatg
gcggtgggctggcatgccgtcgcccgcagcggcgtagagcccggcgggacggctctcatc
gcgggagcgggtccgatcggcatcggtgcctggttcgcgttcaaggcgcgcggtgtggag
aaagttcttgtctccgagccgagtgcggaccgccgcgcgatcgtcgccaggttgggcgcg
acggtcgtcgacccggtgaacgaggatcttggcgctgtgatcgttgagttcaccggcggt
gccggcgtggatgccgcggtggatgccgcgggtgcgggcgccgcgatcacctcggcattg
gccggtttggtcgccggtgggcgcatcgtcgtcgccgcacttcacgagcacccgatggac
ttccagcccacgatgctcatgatgggggagaccgagatcgtaggcgcggtcggctacgaa
cccgaggagttcgacgccgtgatcgctgcaatggccaacggtgtctacgacaccaccggt
tgggtagaggagcgacctctggcaggcatcgtcgacgctctccacaccctgcggagcggc
gccggcgcaaagattctcatcaagacagactga

DBGET integrated database retrieval system