KEGG   Mycobacterium sp. VKM Ac-1817D: G155_26480Help
Entry
G155_26480        CDS       T03634                                 

Definition
(GenBank) 4,5-9,10-diseco-3-hydroxy-5,9, 17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00984  Steroid degradation
myv01100  Metabolic pathways
myv01120  Microbial metabolism in diverse environments
myv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:myv00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    G155_26480
Enzymes [BR:myv01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     G155_26480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF1057 Esterase Abhydrolase_2 Ndr
Motif
Other DBs
NCBI-ProteinID: AIY48482
UniProt: A0A0A1G018
Position
complement(5545694..5546569)
Genome map
AA seq 291 aa AA seqDB search
MTATQEITFESTSRYADVQAGELAMRLHYHEAGDPTKQTIVLLHGGGPGASSWSNFGRNI
TVLAEHYHVLAIDQPGYGLSDKHTEHEQYNRYSAKAVLGLLDKLEITGRVPLLGNSLGGG
TAVRFALDYPDRAGKLVLMGPGGLSVNLFAPDPTEGVKALAKFNYEPTRENLEAFIRIMV
FDQKLVTPELVDERFAIASTPESLAATRAMGKSFAGADFELGMMWREVYKLRQPVLLIWG
REDRVNPLDGALVAVKQIPRVQLHVFGQCGHWAQVEKFDEFNKLTIDFLGG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgactgctacgcaagagatcacttttgaatccacctcccgctacgccgatgtgcaggcc
ggcgagctggccatgcggttgcactaccacgaggccggcgacccgacgaagcagaccatc
gtgctgctgcacggcggcgggcccggtgcgtccagctggtcgaacttcggccgcaacatc
acggtgctggccgagcactaccacgtgctggccatcgaccagccgggttacggcctgtcg
gacaagcacaccgagcatgagcagtacaaccgctacagcgccaaggcggtgctcggcctg
ctcgacaagctggagatcacgggacgcgttccgctgctgggcaactcgctcggcggcggc
accgcggtccgcttcgcgctggactatccggaccgcgcgggcaagctcgtgctgatgggc
ccgggcggtctgtcggtcaacctgttcgcgccggatccgaccgagggcgtcaaggcgctg
gccaagttcaactatgagccgacgcgcgagaacctcgaagccttcatccggatcatggtg
ttcgaccagaagctggtcacccccgagctggtcgacgagcggttcgcgattgccagcacg
ccggagtcgctggccgccacccgcgcgatgggtaagtcgttcgccggtgcggacttcgag
ctcggcatgatgtggcgcgaggtgtacaagctgcgtcagccggtgctgctgatctggggc
cgcgaggaccgggtcaacccgctcgacggcgcactggtcgccgtcaagcagattccgcgg
gtgcagcttcacgtcttcgggcagtgtggacactgggctcaggtcgagaagttcgacgag
ttcaacaaactcaccatcgatttccttgggggttag

DBGET integrated database retrieval system