KEGG   Myroides sp. ZB35: BK054_14260Help
Entry
BK054_14260       CDS       T04543                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
myz  Myroides sp. ZB35
Pathway
myz00220  Arginine biosynthesis
myz00330  Arginine and proline metabolism
myz01100  Metabolic pathways
myz01110  Biosynthesis of secondary metabolites
myz01130  Biosynthesis of antibiotics
myz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:myz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BK054_14260
   00330 Arginine and proline metabolism
    BK054_14260
Enzymes [BR:myz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BK054_14260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: APA93367
Position
complement(3206068..3206463)
Genome map
AA seq 131 aa AA seqDB search
MFCVGNREYDEEYEKPIKESKAVYYPLSKLRSYGIKRVVSDFLMRAEEYDLEGYFIHLDV
DVLNDKIMPAVDCRQEDGLSYRELKEILIPLVQDKRCVGLEIAILDPDLDPLGIYTKEFI
ENVRDIIGVSL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
gtgttttgtgtagggaatagagagtatgacgaagaatatgaaaagcctataaaagagtct
aaggctgtttactaccctttgtctaaattaagaagttatggaataaagagagttgtatca
gattttttgatgcgcgctgaagagtatgatttagagggatactttattcatttagatgta
gatgtcctaaacgataagataatgcctgcggtagactgtagacaagaagatgggttgagc
tatagggagttaaaagaaatacttatacctttggttcaggataaaagatgtgtgggattg
gagattgcgatacttgatccagacttagatcctttaggtatttatactaaagagtttatt
gaaaatgtaagagatattataggagtatctctataa

DBGET integrated database retrieval system