KEGG   Methylorubrum zatmanii: B2G69_16685Help
Entry
B2G69_16685       CDS       T04981                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mza  Methylorubrum zatmanii
Pathway
mza00790  Folate biosynthesis
mza01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mza00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B2G69_16685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mza04147]
    B2G69_16685
Enzymes [BR:mza01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     B2G69_16685
Exosome [BR:mza04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B2G69_16685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ARO55595
UniProt: A0A1W6RKZ6
Position
complement(3581072..3581449)
Genome map
AA seq 125 aa AA seqDB search
MTQAREGVLDDATVERRLKEELPHWRLEDGWIRRTYKTASWKSTLMVINTVGHLAEAAWH
HPDLTASYAWVEVRLMNHAAKGITEKDFSLAKKIEEVVGWQPGAEGGALEGTPADPRFAY
IKYDK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagcacgcgagggcgtcctcgacgacgcgacggtggagcggcggctgaaggaa
gagttgccgcactggcggttggaggacggctggatccggcgcacctacaagaccgcctca
tggaagagcacgctgatggtcatcaacacggtgggccatctggccgaggccgcgtggcac
catcccgacctcacggcgtcctacgcttgggtcgaggtccggctgatgaaccacgccgcc
aagggcatcaccgagaaggatttctctctggcaaagaagatcgaggaggtcgtgggctgg
cagccgggcgcggagggcggcgccctcgaaggaacgccggccgatccgcgcttcgcctac
atcaagtacgacaagtga

DBGET integrated database retrieval system