KEGG   Methylorubrum zatmanii: B2G69_17515Help
Entry
B2G69_17515       CDS       T04981                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mza  Methylorubrum zatmanii
Pathway
mza00230  Purine metabolism
mza00240  Pyrimidine metabolism
mza01100  Metabolic pathways
mza01110  Biosynthesis of secondary metabolites
Module
mza_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mza_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mza_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mza00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    B2G69_17515
   00240 Pyrimidine metabolism
    B2G69_17515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mza04131]
    B2G69_17515
Enzymes [BR:mza01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     B2G69_17515
Membrane trafficking [BR:mza04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    B2G69_17515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ARO55749
UniProt: A0A1W6RLM0
Position
3762901..3763323
Genome map
AA seq 140 aa AA seqDB search
MANERTFSILKPDATRRNITGAVNAVIEAAGLRIVGQRRIRMTREQAEKFYEVHKERPFF
GELVEFMTSGPVVVQVLEGENAVAKYREVMGATNPAQAADGTIRKQFAESVGENTVHGSD
SADNARLEIAQFFNDADIAA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgagcgcaccttctccattctcaagcccgacgcgacgcgccgcaacatcacc
ggcgcggtcaacgccgtgatcgaggccgccggcctgcgcatcgtcggccagcgccgcatc
cgcatgacccgcgagcaggccgagaagttctacgaggtgcacaaggagcgcccgttcttc
ggtgagctggtcgagttcatgacgtcgggccccgtggtcgtgcaggtgctcgagggcgag
aacgccgtcgccaagtaccgtgaagtcatgggcgccacgaacccggcccaggccgccgac
ggcacgatccgcaagcagttcgccgagtcggtcggtgagaacaccgttcacggctccgac
agcgccgacaacgcacggctcgagatcgcgcagttcttcaacgacgccgacatcgccgcc
tag

DBGET integrated database retrieval system