KEGG   Methylorubrum zatmanii: B2G69_23785Help
Entry
B2G69_23785       CDS       T04981                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mza  Methylorubrum zatmanii
Pathway
mza00071  Fatty acid degradation
mza00072  Synthesis and degradation of ketone bodies
mza00280  Valine, leucine and isoleucine degradation
mza00310  Lysine degradation
mza00362  Benzoate degradation
mza00380  Tryptophan metabolism
mza00620  Pyruvate metabolism
mza00630  Glyoxylate and dicarboxylate metabolism
mza00640  Propanoate metabolism
mza00650  Butanoate metabolism
mza00900  Terpenoid backbone biosynthesis
mza01100  Metabolic pathways
mza01110  Biosynthesis of secondary metabolites
mza01120  Microbial metabolism in diverse environments
mza01130  Biosynthesis of antibiotics
mza01200  Carbon metabolism
mza01212  Fatty acid metabolism
mza02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mza00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B2G69_23785
   00630 Glyoxylate and dicarboxylate metabolism
    B2G69_23785
   00640 Propanoate metabolism
    B2G69_23785
   00650 Butanoate metabolism
    B2G69_23785
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B2G69_23785
   00072 Synthesis and degradation of ketone bodies
    B2G69_23785
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B2G69_23785
   00310 Lysine degradation
    B2G69_23785
   00380 Tryptophan metabolism
    B2G69_23785
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B2G69_23785
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B2G69_23785
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B2G69_23785
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mza04147]
    B2G69_23785
Enzymes [BR:mza01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B2G69_23785
Exosome [BR:mza04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B2G69_23785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ARO57598
UniProt: A0A1W6RS05
Position
complement(5135429..5136637)
Genome map
AA seq 402 aa AA seqDB search
MPEAYIYDHVRTPRGRGKPDGSLHEVTALRLAETALRALKDRNGLDTRQVDDVVLGCVDP
VGEAGGDIARAAALVADYGTHVPGVQINRFCASGLDAINFAAAQVMAGQHDLTVGGGVES
MSRVGLGASGGAWPVDPAIAVKSYFMPQGVSADLIATKYGFSRDDCDAYAVESQKRSAQS
WGEGLFKNSVVPVRDINGITLLDRDEHMRPTTDMQSLASLKPSFVQMGQMGGFDAVAVDA
HPDVEAVHHVHHAGNSSGIVDGAAAVLIGSREAGDAAGLRPRARIRAFANIGSDPALMLT
GPVDVTKKVLARAGMSLSDIDLFEINEAFASVVLRFHQAFDLDPAKVNVNGGAIAMGHPL
GATGAMILGTVLDELERTGKERALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggcctacatctacgatcacgtccgcaccccccgcggccgcggcaagccggac
ggttcgctgcacgaggtgacggcgttgcgcctcgccgagacggcgttgcgcgcgctcaag
gaccgtaacggcctcgacacgcggcaggtggacgacgtggtgctgggctgcgtcgatccg
gtcggcgaggccggcggcgacatcgcccgcgccgccgcgctcgtggccgattacggcacc
cacgtgcccggcgtgcagatcaaccgcttctgtgcctcgggcctcgacgccatcaacttc
gccgcggcgcaggtcatggccggccagcacgacctcaccgtcggcggcggcgtcgaatcg
atgagccgcgtcggcctcggcgcctcgggcggcgcttggccggtcgatccggcgatcgcg
gtcaaatcctacttcatgccgcagggcgtctcggccgatcttatcgccaccaagtacggg
ttcagccgcgacgattgcgacgcctacgccgtcgagtcgcagaagcgctcggcccaatcc
tggggcgagggcctgttcaagaactccgtcgtgccggtgcgggacatcaacggcatcacc
ctgctcgaccgcgacgagcatatgcggccgacgaccgacatgcagtcgctggcgagcctg
aaaccgtccttcgtgcagatgggccagatgggcggcttcgacgccgtggccgtcgatgcc
cacccggatgtcgaggcggtccatcacgtccaccatgccggcaactcgtcgggcatcgtg
gatggcgcggcggcggtgctgatcggctcgcgcgaggccggtgacgccgcgggcctgcgg
ccccgcgcccgcatccgggcgttcgccaatatcggctccgatccggcgctgatgctgacc
ggcccggtcgacgtcacgaagaaggtgttggcgcgggccggcatgagcctgtccgacatc
gacctgttcgagatcaacgaggccttcgcctcggtggtcctgcgcttccatcaggccttc
gacctcgacccggcgaaggtgaacgtcaacggcggcgccatcgccatgggccatccgctg
ggtgccacgggcgcgatgatcctcggcaccgtgctcgacgagctggagcgtaccggcaag
gagcgggcgctcgtgaccctgtgcatcggcgccggcatgggcaccgccacgatcatcgag
cgggtgtga

DBGET integrated database retrieval system