KEGG   Maylandia zebra (zebra mbuna): 101464130Help
Entry
101464130         CDS       T02814                                 

Gene name
st6gal2
Definition
(RefSeq) beta-galactoside alpha-2,6-sialyltransferase 2
  KO
K00779  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00510  N-Glycan biosynthesis
mze00514  Other types of O-glycan biosynthesis
mze01100  Metabolic pathways
Module
mze_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    101464130 (st6gal2)
   00514 Other types of O-glycan biosynthesis
    101464130 (st6gal2)
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     101464130 (st6gal2)
Glycosyltransferases [BR:mze01003]
 Terminal extension
  Sialyltransferase
   101464130 (st6gal2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 101464130
NCBI-ProteinID: XP_004551343
Position
LG16
AA seq 550 aa AA seqDB search
MLVGPQSWRACEKEAMKSSMRHWRRLMLVGILAWALFFLALLSYFLDARVDEPLTSAGAL
LSQHPDTRRLTSIQASHQQHAVVKLTLPLTTTYPRDKPELEPLVKSGTPETSLEMSQNPN
NLPYAVYGSQEVSRQDYLDPQSLAAWSSFGTENVGSHSDPVVQSRERQSQTADYQNHFSN
TQYQGGREEGDEKENEDLGNRRKNRVHSMAGDDFSDLEEFYFSKSISLIKRLWKGRVSAG
MLSLRLQRAMKEYVNSNKHHVSYKGNRKPAQSAKELLCELKNQARLRTVDGLEQPFSSLG
WARLVPSLPLEQLYKKENRRSFKTCAVVTSAGAILRSRLGKEIDAHDAVLRFNAAPTEGY
ERDVGNKTTIRIINSQILANPRHRFNTSSIYKNITLVAWDPAPYAVNLHKWYTSPDYNLF
GPYMEHRKLHPDQPFYILHPSYVWQLWDVIQGNTEEDIQPNPPSSGFIGILLMMALCEQV
HVYEYIPSMRQTDLCHYHEAYYDAACTLGAYHPLLYEKSLIQRINMGPVSDLERKGRVTL
PGFSTVNCDI
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgggcccacagagctggcgtgcatgtgagaaagaggcaatgaagtccagtatg
aggcactggcggaggctgatgctggtgggaatactggcctgggctctcttctttctcgcc
ctcctgtcatatttcctggatgctcgtgtggatgagccccttacttctgctggtgcttta
ctctcccagcacccagacacacgccgtctgacctccatacaggcctcccatcaacagcat
gccgtggtaaagctgactttgccattaactacaacgtatcccagagataaaccggagctg
gagcctcttgtcaagtccgggaccccagagaccagcctggagatgagccagaacccaaac
aatcttccttacgctgtttatggcagccaggaagtaagtcgccaggactatcttgaccca
cagagcctggcagcctggtcttcctttggtacagaaaatgtgggttctcactcagatcct
gtagtccagagtcgtgagcgacagtcacagactgcagactatcagaaccacttcagcaac
actcaataccaaggtggcagggaggaaggtgatgaaaaagaaaatgaagatctgggaaac
agaaggaagaacagagtacacagtatggccggcgatgacttctctgatctggaggaattc
tatttctccaaatccatctcgctaataaagcggctctggaagggtcgagtgtcggcaggc
atgctgagtcttcgactgcagcgtgccatgaaggaatacgtcaactccaacaaacaccat
gtttcctacaaggggaatcgcaagcccgctcagagtgccaaggagctgctttgtgaattg
aagaatcaggcccggctgaggacagtagacgggttggagcaacccttctcttcacttggc
tgggctcgtctggtgccatcccttcccctggagcagctgtacaaaaaggagaacaggaga
agcttcaagacctgtgctgtggtcacctctgctggggccatccttcgctcacgattaggc
aaagagattgacgctcatgatgcagttttacgtttcaatgctgcacctacagaaggctac
gagagagacgtgggaaacaaaaccactatccgcatcatcaactcgcagattttggcaaat
cctaggcatcggttcaatacgagctctatctacaagaatataactctggtggcctgggac
cccgcaccttatgctgtcaacttacacaagtggtacactagtccggactacaacctgttc
ggtccatacatggagcaccgcaagctgcatcctgaccagcccttctacatccttcaccct
agctatgtgtggcagctctgggacgtgattcagggcaacacagaggaggacatccaaccc
aaccccccatcatctggcttcataggtatcctcctgatgatggcgctgtgcgagcaggtg
cacgtgtacgagtacattccctccatgaggcagacggacctgtgccactaccacgaggcc
tactatgacgctgcgtgcacactgggtgcctaccatcctctcctctatgagaaaagcctg
atccagcgaatcaacatgggccccgtgagtgacctcgagaggaaaggacgcgtcactctt
ccaggcttcagcaccgtgaactgtgacatctga

DBGET integrated database retrieval system