KEGG   Maylandia zebra (zebra mbuna): 101464297Help
Entry
101464297         CDS       T02814                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101464297
   04020 Calcium signaling pathway
    101464297
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mze04040]
    101464297
Ion channels [BR:mze04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101464297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel TMEM208_SND2
Motif
Other DBs
NCBI-GeneID: 101464297
NCBI-ProteinID: XP_014266966
Position
LG6
AA seq 2184 aa AA seqDB search
MMVILLNCVTLGMYQPCENIDCSSDRCQILQAFDAFIYIFFAMEMVVKMIALGIFGRRCY
LGDTWNRLDFFIVMAGMVEYSLDLQNVNFTAIRTVRVLRPLKAINRVPSMRILVNLLLDT
LPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCYPEENFTLSSGVSLPRPYYMADEDDE
RPFICSLPVDNGIMSCSDVPARREGGKTCCLDKDDILYRQSIGLSPEPLANGSVSVAGLC
VNWNQYYTRCHTGYSNPHKGAINFDNIAFAWIVIFQVITLEGWVEIMYYVMDAHSFYNFI
YFILLIIVGSFFMINLCLVVIATQFSETKQREHQLMQEQRARCSSSSTLASEPGDCYEEL
FQLVCHFLRKARRQTVALFNTLRGKPRGFHGVGRGRGGGEGRERKANGREGRDRRAGLRH
GPPCPHHNKLGHASSAEPVALTAASATAGCPQCAAALALSDGVGPVRNAASDETEEGTVE
ESDRDGVQSSTKGKDKQGHEGAESCCSPKKGCKELWYEIRMKLWGIVESKYFNRGIMIAI
LINTISMGIEHHEQPEELTNVLEICNIVFTSMFSLEMILKLTAFGSFNYLRNPYNVFDGI
IVIISVCEIIGQSDGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLM
LFIFIFSILGMHIFGCKFSLKTETGDTVPDRKNFDSLLWAIVTVFQILTQEDWNTVLYNG
MAATSPLAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDDDHSSSNFDESEK
RDSIKLSDPRICTLTPNGHLELGALSAPRGSYSSERRSFTMDSRKSSVMSLGKSSLERRS
LSLRHGGSSNYHNWGRPFPPQSGWSRRSSSNSLGRRSYGFSGLPPVGGSLRLHSTRSPHS
YTFAPEQESLLSHPAHSHHPLPPHHPPPPPFFLSRHFAARRDRRALSLELPELFRAGGQP
PGLPPIHPDAGKRSGSGAGGSITGGSVAGSGLGVDHRDCNGKAPGPHTQLMVEVFPQVNA
RKDRTDLDEETDYSLCFRIQKMMEVYKPDWCETREEWSVYMFSPQNKFRLLCQSVIAHKL
FDYVVLAFIFLNCITVALERPKILQGSLERLFLTISNYIFTAIFVGEMTLKVVSMGLYLG
ETAYLRSSWNILDGFLVFVSLIDIVVSMAGGAKILGVLRVLRLLRTLRPLRVISRAPGLK
LVVETLITSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYYCVGLDVKNITNKSDCLAAN
YRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYHGLDAVGIDQQPMINNNPWMLLYFIS
FLLIVSFFVLNMFVGVVVENFHKCRQHQEVEEARRREEKRQRRMEKKRRKAQKLPYYASY
GPTRLAIHALCTSHYLDLVITFIICINVITMSLEHYDQPQSLETALKYCNYFFTSTFVIE
ASLKLVAFGFRRFFKDRWNQLDLAIVLLSVMGITLEEIEINASLPINPTIIRIMRVLRIA
RVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGELVCNADYPCE
GMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRECPPDRPGTDYGCHAGLQFISPMY
FVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELELAQGGLCCMMGGIGAI
AGATVATASGAGVGGGVSGAITAGTVGGPSSGLMAPLRDGGGGSATHEGHTHPRCRLYSP
AQESQWLDSVSLLIKDSLEGDLIDNLSGSVFHHYGSPPICKDCKSHPQEVRLAEVEQASL
MSEQLSDKSSSPALPDDLSLDENSSYQLLVRDSQRGSSDSRSSEELPRQAGYRGLRPSSS
GSEEGVQGLFEVGIHHQCNPASPEQKSPAHDKDDDGGSCSGGARETSPVLHLPADFFHPA
AAAHPNSPGNSVSPGDRQPSRSASPASWASLRSPRANSRPLGSQHPSHSDSSLATASSEG
SLQAALEEGLSFSVSSPRYLDLPTPHLCPVPSHPSQRQTPTTGDQGCSLLKRHSTPLTLQ
ATRRHQRSQSSSRGGSTSPGCPQQDSVDPSDEDVGTGTNRDDCRQTFSSEHLSETLNSLS
LTSLFTPDSLAPPLVKKCNSTGSLDLTNLSARSKDGHHFHGIHVHGFLSNPLTEGMARGE
EQDITGLSMKSRRQTADTCSRKNR
NT seq 6555 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgatccttttgaactgtgttaccctgggaatgtaccagccctgtgagaacatc
gactgctcctcagaccgatgccagatactacaggccttcgatgcgttcatctacatcttc
tttgctatggagatggttgtaaaaatgatcgctctggggatctttggtcgacgctgttac
ctcggggacacgtggaacaggctggatttctttatcgtcatggcagggatggttgagtac
tctctggacctgcagaacgtcaacttcacggccatcagaacagtgagggtgctgcggcca
ctcaaagcaattaacagggtgccaagcatgcgtatcctggtgaacctgctgctcgacaca
ctgcccatgctgggtaacgtccttctcctctgctttttcgtcttcttcatcttcggcatc
ataggagtgcagctgtgggcagggctgctgagaaaccgctgctaccccgaggagaacttc
acactcagtagcggagtcagtctccctcggccttactacatggctgatgaggatgacgag
cgtccttttatctgctcccttcctgttgacaatggcatcatgtcttgctccgatgtgccg
gcccgccgagaaggaggcaagacatgctgcctggacaaagatgacatcctgtatcgccag
tctatcggtctgagccccgagcccctggccaacggcagcgtcagtgtagcagggctctgt
gtgaactggaaccagtactacaccaggtgtcatactgggtacagcaacccccacaaagga
gccatcaactttgacaacattgcctttgcctggattgtcatctttcaggtgatcactctg
gagggctgggtggagatcatgtactacgtgatggatgctcattcattctataacttcatc
tacttcatcctgcttataattgtcggttccttcttcatgatcaacctgtgcctcgtggtc
attgccacccagttctcagagaccaagcagcgggagcatcagctgatgcaggagcagcga
gctcggtgttcatcctcctccaccctggccagtgaacctggggactgctacgaagagctc
ttccagctggtctgccatttcctccgaaaggcgaggaggcaaactgttgccctttttaac
accctccgggggaaacctcgtggctttcatggtgttggaagaggaagaggaggcggggaa
ggaagggagaggaaggccaatggacgtgaaggacgtgacagaagagcggggttaagacat
ggcccgccatgtccccatcacaacaaactaggccatgcctcatccgctgagcctgtggcc
ctcactgctgcctccgccacagccggctgccctcagtgcgcggcagcgctggcgctctct
gacggggtgggaccagttcgaaatgcagcgagtgacgaaacagaagagggaactgtggag
gaatcagacagggatggtgtacagtccagtactaaagggaaggacaaacaaggccatgaa
ggtgcagagtcttgttgtagtccgaagaagggatgcaaggagctgtggtacgagatcagg
atgaaactgtggggcatcgtggagagcaagtattttaaccgaggcatcatgatcgccatt
ttgatcaacaccatcagcatgggcattgagcaccacgagcagccagaggagctcaccaat
gttctggagatctgcaacatcgtctttacaagcatgttctccttggagatgatcctcaag
ctcacagcttttggctctttcaactacctgagaaacccttacaacgtctttgatggaatc
attgtcatcataagtgtgtgtgagattatcggccagtcggacggtggtttgtctgttttg
aggaccttcaggctgctgagggtgctgaaactggtgaggttcatgccagctctcaggaga
cagctggtggtcctgatgaagaccatggacaacgtggccaccttctgcatgttactaatg
ctcttcatcttcatctttagtatccttgggatgcacatttttggatgcaaattcagtctt
aagacggagaccggagacacagtaccagacaggaagaactttgattccttgctgtgggcc
attgtcaccgtttttcagattctgacccaggaggactggaacacagttttgtacaatggt
atggcagcgacctcaccgcttgctgctctgtactttgtggccctcatgacatttggaaac
tacgtcctcttcaacctgctggtcgccatcctggttgaaggctttcaggcagagggtgat
gcaaatcgttcatattcagacgatgatcactcctcctccaactttgacgagagtgaaaaa
cgtgactccatcaagttgtctgacccgaggatctgcaccctgacaccaaacggccacctg
gagctgggtgccctttcagcacccaggggatcctactcctcggagaggcggagcttcacc
atggattctagaaagagcagcgttatgagcctgggcaagagcagcctggagagacgctcc
ctctccctgcgccacggtggcagttccaactaccacaactgggggcgtccgttccctccg
cagtctggatggagtcgcaggtctagctcaaacagcctaggtcgaaggagctatgggttc
agcggattacctccagtgggaggcagcctccgcttgcacagcacccgctcgccccactcc
tacacctttgcgccagagcaggagtcccttctttcccacccagcccactcccatcatcct
ctgccccctcatcatccacctccgcccccatttttcctctccaggcattttgctgcaagg
agagatcggcgggctctttccctcgaactccctgaattgtttcgggcaggtggacagccg
ccaggccttcctcccatccacccagacgctggcaaaaggagtgggtctggagcggggggc
tccattacaggagggtctgtggccggcagcggtttaggagtggatcaccgggactgtaat
ggcaaggcaccaggtccccacactcagcttatggttgaggttttccctcaagtcaatgca
cgcaaggacagaacagaccttgatgaagaaacagactatagtttgtgcttccgtatccag
aagatgatggaggtgtataagccagactggtgtgaaaccagagaggagtggtcagtctac
atgttctcccctcagaataagttcagactgctctgccaatctgttattgcccataaactc
tttgactacgtggtgctggccttcatattcctcaattgcatcacagtggctctggagagg
ccaaagattcttcaaggtagcctggaaagactgtttcttaccatttccaactacatcttt
actgccatcttcgttggggagatgactctcaaggtggtgtctatgggtctgtatttgggg
gaaactgcctatctgagaagcagctggaacattctagatggtttcttggtcttcgtgtct
ctgattgacatcgtagtgtccatggcgggtggggctaagatcctcggggttctccgtgtg
ctcaggttgctcaggacactccgtcctctcagggtgatcagcagagctccaggactgaag
ctggtggtcgagaccctaatcacgtccctcaagcccatcggcaacattgtcctcatctgc
tgtgcctttttcatcatctttggcatccttggtgttcagcttttcaaaggaaagttctac
tactgtgtgggtctcgatgtgaagaatatcaccaataaatctgactgcctggctgccaac
tatcgatgggttcaccacaaatacaactttgacaaccttggacaggctcttatgtccctg
tttgtgctggcatcaaaagatggctgggtcaacatcatgtaccatggactagatgcagtg
ggaattgaccagcagccgatgatcaacaacaacccatggatgctgctctacttcatctcc
tttttgctgattgtcagcttcttcgtccttaacatgtttgtgggtgtggtcgtggagaac
ttccacaaatgtcggcagcaccaggaggtggaggaggccagaagacgtgaggagaaacgc
cagcgtcgcatggagaagaaaaggagaaaggcacagaagctgccctactatgcatcttat
ggtcctacacgcctggctatccatgctctgtgcaccagccactacctggatctggtcatc
accttcattatctgcattaatgtcatcaccatgtctctggagcactacgaccaaccacag
tctctggagactgcattaaagtactgcaactacttcttcacgtccacgttcgtgatcgag
gcctctctcaaactggtagcttttggctttcggcgcttcttcaaggacaggtggaaccag
ttggatttggccattgtgctgttgtcagtgatgggcatcaccctggaagagattgagatc
aatgcctcgctccccatcaaccccaccatcatcaggatcatgagggtgctcaggatagca
cgagtgttgaagttgttgaaaatggcaacggggatgagagctcttcttgacaccgtggtc
caagctctgcctcaggtggggaacttgggcctactcttcatgttgctgtttttcatctat
gctgctctgggtgtggagctgtttggagaactagtgtgtaatgctgactacccctgtgaa
ggaatgagccgccatgctacctttgaaaactttggaatggccttccttacgctcttccag
gtttcaactggcgacaactggaatggcatcatgaaggacaccctgagagagtgcccgcct
gatcgtccaggaaccgactacggctgtcatgccggactgcagttcatctccccgatgtat
ttcgtgtcattcgtgctcacagctcagttcgtactgataaacgtggtggttgccgtgctg
atgaaacatctagacgattccaacaaggaggcacaggaggatgccgagatggatgcagag
attgaattggagttggcccagggaggcctgtgctgcatgatgggaggcatcggagctatc
gctggggccaccgttgccactgcgagcggggcaggcgtaggtggcggagtgtctggcgca
attacagcgggaacagtcggaggcccaagtagcggattgatggcaccacttcgagatgga
ggaggagggagcgctactcatgagggacacactcaccctcgatgtcgcctctactcccct
gcacaggagagccagtggctggacagcgtctctctgctaattaaggactcgttagaagga
gacctgatcgacaatctctccggttcagtttttcaccactacggctctcctcctatctgc
aaagactgcaagagtcaccctcaagaggtccgactggcagaggtggagcaggcatcgctg
atgtcagagcagctgtccgacaagtcatcgtctccagctctgcctgatgacctgagtttg
gatgaaaacagcagctaccagctgctggtcagagacagccagaggggcagcagtgactcc
cgcagttcggaagagttgcccagacaggcgggttacagagggcttcgtccctccagctca
ggaagcgaggagggtgttcaggggctgtttgaagtgggcatccatcatcagtgcaatcct
gcctcaccggagcagaaaagccctgcacatgacaaagatgatgatggaggaagctgcagt
ggaggtgctcgtgaaacttcaccagtcttgcatctaccggcagatttcttccacccagct
gctgcagctcatccaaacagtcctggaaacagcgtaagcccaggagacagacagccttcc
aggtcggcctccccagcctcctgggcgtccctccgctcacccagagccaacagcaggccg
ttgggctcccagcacccgtcccacagtgactcctctttggccacagccagttcagagggc
agcctgcaggcagcactggaagaagggctgagcttcagcgtctcctcacctcgatatctg
gatctccccacaccccacctctgccctgtccccagccacccctcgcaacgccagacaccg
actacaggagaccagggctgctctttactaaagagacacagtactcctttgaccctccaa
gccacccggaggcaccagaggagccagagcagcagcagaggcggcagcaccagccccggt
tgcccccagcaggactccgtggacccgtcagatgaggatgttggcacggggacaaaccgg
gatgactgccgtcaaaccttcagcagcgagcacctgtcagaaacactgaacagtctctcc
cttacgtcactgtttaccccggactctttggcacccccgctggtgaagaaatgcaacagc
acagggtctctggacctaacgaatctgtctgcccggagtaaagatggccaccactttcat
ggcatacacgtccatggtttcttatccaaccccttgacagagggaatggcaagaggtgaa
gagcaagacatcacaggcctcagcatgaaaagcaggcgtcagaccgcagacacatgctcc
aggaaaaacagatga

DBGET integrated database retrieval system