KEGG   Maylandia zebra (zebra mbuna): 101465766
Entry
101465766         CDS       T02814                                 

Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00230  Purine metabolism
mze00240  Pyrimidine metabolism
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101465766
   00240 Pyrimidine metabolism
    101465766
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     101465766
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_17 Thymidylate_kin AAA_28
Other DBs
NCBI-GeneID: 101465766
NCBI-ProteinID: XP_004556998
Position
LG10
AA seq 270 aa
MATPPKRPCPPPRSPPLNGSFSRQRKEKKISIEGNIAAGKSTFVRLLQAASEDWEVIPEP
IGKWCNVQNDSDDVYLELSSSQKSGGNLLQMLYDKPSRWSYTFQSYACLSRVRAQLQSPS
IKLQQAENPVQFYERSVYSDRYVFASNLFESGDLSETEWSVYQDWHTWLMNQFESDIALD
AIIYLRAPPQRCMQRLLHRGRQEEQEIPLEYLEQLHFKHEAWLYHRNLRLDFDYLSELPV
LVLDVNDDFKNDRIKQEAIIDKVREFLTTL
NT seq 813 nt   +upstreamnt  +downstreamnt
atggcgacccccccgaagaggccgtgcccccctccccgcagcccgccgctgaacggcagc
ttttcccgtcaaaggaaggagaagaagatctccatcgaaggaaacatagctgcaggaaag
tcgacatttgtgcgcctccttcaggcagcatcagaggactgggaggtcatccctgaaccc
attggcaagtggtgcaacgtgcagaatgacagcgatgacgtttacctggagctgagctca
tctcaaaagagtggaggaaacctgctgcagatgctgtacgataaacccagccgctggtcc
tacaccttccagagctacgcgtgtctgagcagagttcgagctcagcttcagtcgccatca
atcaaacttcagcaggcagaaaaccccgtccagttctacgagcgctccgtctactccgac
aggtacgtgtttgcgtcaaacctgtttgagagtggcgacctgtcggagacggagtggagt
gtgtatcaggactggcacacctggttaatgaaccagtttgagtccgacatcgctctcgac
gccatcatctacctcagagccccgccacagcgctgcatgcagcggctgcttcatcgcggc
cggcaagaagagcaggaaattcctctggagtaccttgagcagctgcacttcaaacatgaa
gcctggctctaccacaggaacctcaggttggactttgattatttgagcgaacttcctgtt
ctcgtcctggacgtcaacgacgacttcaagaacgaccgcatcaaacaggaagccatcatc
gacaaggtcagagagtttctcaccacactgtga

DBGET integrated database retrieval system