KEGG   Maylandia zebra (zebra mbuna): 101465780Help
Entry
101465780         CDS       T02814                                 

Gene name
cacng3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04260  Cardiac muscle contraction
mze04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101465780 (cacng3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101465780 (cacng3)
   04261 Adrenergic signaling in cardiomyocytes
    101465780 (cacng3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mze04040]
    101465780 (cacng3)
Ion channels [BR:mze04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101465780 (cacng3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 101465780
NCBI-ProteinID: XP_004560777
Position
LG4
AA seq 317 aa AA seqDB search
MKMLMCDRGVQMLVTTVGAFAAFSLMTIAVGTDYWLYSRGVCRVKSSGDNDTSRKNEEVM
THSGLWRTCCLEGTFRGVCKKIDHFPEDADYEADAAEYLLRAVRASSLFPIMSVGLLFLG
GLCVAASEFYRSRHNVILSAGIFFVSAGLSNIIGIIVYISANSGDPGQSDSKKSYSYGWS
FYFGALSFIMAEMVGVLAVHMFIEKHRKLRAKSRTELIKKSAFSRIPSYRYRFRRRSSVR
SSEAPSRDASPLGKGGYTGPAASEMPMYTLNPREAGNAGSKPVGGLGGLLNSERDFLQSS
TLTKDYSKDPNRRTTPV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgctgatgtgtgaccgcggcgtccagatgctcgtgacgacggtgggcgcgttc
gccgccttcagcctcatgaccatcgccgtcggtaccgactactggctgtactcgcgcggg
gtgtgccgcgtgaagagcagcggcgacaacgacacgagccgcaagaacgaggaggtgatg
acgcactccggcctctggcgaacctgctgtctggaaggaaccttcagaggtgtgtgtaag
aaaattgatcacttcccagaagatgctgactatgaagcagacgcagctgaatacctccta
cgtgctgtgcgtgcctccagtcttttccccatcatgagtgtgggtctgctgtttctgggt
gggctctgcgtggctgccagtgagttttaccgaagccgacacaacgtcatcctcagcgca
ggaatcttcttcgtctcagcaggcctcagtaacatcattggaattattgtctatatctca
gccaactctggcgacccaggccagagtgacagcaagaagtcctactcctatggctggtct
ttttacttcggggccctctccttcattatggcggaaatggtgggtgtgctggctgtgcac
atgttcattgagaagcaccgcaagctccgggccaagtcccgcactgagctcatcaagaag
tccgcctttagccgcatcccctcctatcgctaccgtttccggcgccgctccagcgttcgc
tcttcagaggctcccagccgcgatgcctcgccactggggaaaggtggctacacagggccc
gccgcctccgagatgcccatgtacacgctgaacccacgagaggccggcaatgccggcagc
aaacctgttggcggcttaggcgggctgcttaactcggagagggatttcctccagagcagc
acgctcactaaagactacagcaaggaccccaaccgcagaaccacacctgtctga

DBGET integrated database retrieval system