KEGG   Maylandia zebra (zebra mbuna): 101465958Help
Entry
101465958         CDS       T02814                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00010  Glycolysis / Gluconeogenesis
mze00562  Inositol phosphate metabolism
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101465958
   00562 Inositol phosphate metabolism
    101465958
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101465958
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101465958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Exostosin
Motif
Other DBs
NCBI-GeneID: 101465958
NCBI-ProteinID: XP_004551626
UniProt: A0A3P9DS97
Position
LG13
AA seq 461 aa AA seqDB search
MLTFLWKFIVFYVFYTSGFLSNYVTFEDEANIPAIAKYFNTKGRYEEVNPYLREDILAVN
RSILQPPLDECQQIHLTAIIRHGTRYPTTKNIKEMQQLYNMILHNASGEQSWLHELQTQW
RMWYTEDMDGRLVQKGVDELKHLAVRLSKLFPSLISEEKLRGGFIKFITSSKHRCVNSTL
SFKAGLTELWHIKDMEFDHAVNDALMRFFDKCTRFLEEVDNNPSAVTEVEKFKQGPEMRR
VQQKIADILNVPYSSITYDVAEAAFYLCAYEFAIRSVKSPWCELFDEDDAKVIEYASDLR
EFWKRGYGHDINSKASCILFHDVFSRMDKTATQNKLGQQVTEAVTVQVGHADTLLPLLTL
LGFFKDSEPLTSTNYAAQAHRSFRTTHMLPYAANLVLVLSDCGGGDLRLQPLLNEKPVTF
PGLTNRSSMPLYRDVLEHYSDLLKGCDFETECQLFKQPAEV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgctgacttttctttggaaatttatagtgttttatgttttttacacctctgggttttta
tctaattacgtgacgttcgaagatgaggctaatataccagcaatcgccaaatatttcaac
acgaaagggaggtacgaggaggttaacccgtatctcagagaggacatacttgctgtaaac
aggtcaattttacagcctccactggatgaatgtcaacaaattcatctgacagccataata
agacatggcacaagatacccgacgaccaaaaatattaaggagatgcagcagctctataac
atgatcctgcacaatgcctcaggagaacagagctggctgcacgaattgcagacccagtgg
aggatgtggtacactgaggacatggacggacgactcgtccagaaaggtgtggatgagctg
aagcacctggctgtcaggctgtcaaagctgttcccctcactgatttcagaggagaagctt
cgaggtggattcatcaaattcataaccagctcaaagcacaggtgtgtcaacagcacactg
tccttcaaggcaggactaacagaactgtggcatattaaagatatggagtttgatcacgcg
gtgaatgacgctctcatgaggttttttgataaatgcaccaggtttttggaggaagttgat
aacaacccatcagctgtgacagaggtggagaagttcaagcaagggccagagatgaggagg
gtccagcagaagatcgcagacatcctcaacgtcccatacagttccatcacatacgatgtg
gctgaggctgcattttacttgtgtgcatacgaatttgcaattaggtcagtgaagtccccc
tggtgtgagctctttgacgaggacgatgcaaaggttattgagtatgcaagtgacctaagg
gaattctggaaaagaggctatggtcatgatattaacagcaaggcaagctgtatcctattt
catgacgtgtttagccgaatggacaagacggccactcagaataagttgggacagcaggtg
actgaagctgtgacagtccaggtgggccatgcagacacccttcttcctctgcttaccctt
ctgggcttcttcaaggacagcgaaccgctgacatcaaccaactatgctgcacaggcccat
cgctcattccgcaccactcacatgttgccctatgcagctaacttggtcctggtgctctct
gactgcgggggaggtgacctcagactacagccgctgctcaatgagaagcctgtaactttc
cccggtttgactaatcggtcttccatgccgctctatcgagatgtcttagagcactacagt
gatctgctcaaaggctgcgactttgaaaccgagtgtcagctgttcaagcagcctgctgaa
gtttag

DBGET integrated database retrieval system