KEGG   Maylandia zebra (zebra mbuna): 101466702
Entry
101466702         CDS       T02814                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mze03036]
    101466702
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    101466702
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank_3 Ank Sod_Ni 7TM_GPCR_Srd
Other DBs
NCBI-GeneID: 101466702
NCBI-ProteinID: XP_004570771
Position
LG3
AA seq 401 aa
MEPVNKPGKRRRGRCKKGKQSHYDALSRQMFPAVAPGNPEKCDLNENQLSLHQQSLPPLH
VACLYGELGDVQLLVKFRQQWINSSDSQGRRPLHMVLSYKSFPRTCACLRYLLEHDADVN
ATTDLGQTPLHLAASEGFLDCAEILVKAGADVLAKDSLGQTPLDLACIWCHRKVARYLKS
CMWHVNKEKERKERVLVQALYTDLVGMAKQNNLTRKTLTDEKVAEWAKKKGVALLKDFSL
REQVSKYHTKCFLADQSNCESKHAKAHCEEQQPEGIKEDRNTLPKPPFKPWSIFTGLQPK
KPLAEPDLRDSVTIWRDSSSRQLQYTTRWDSTPRPAPNLPLDVLERVLFPRAFPSRITWP
QDFESQNMVEVKHQGCPQEHNTSPWTEVAMCLVEVLEFRQY
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggaacctgtcaacaagcccggaaaacggagacgtggaagatgtaaaaaagggaaacag
tcccattatgatgcgctgagcaggcagatgttcccagctgtggctcctgggaacccggag
aagtgtgatttaaatgagaaccagctctccctgcaccaacagagtctgccgccgctccac
gtggcctgcctttatggcgagttgggtgatgttcagctcctggtgaagttcaggcaacag
tggatcaacagcagtgattcccaaggtcgccggcccctccacatggtcctgtcctacaag
agcttccccagaacctgcgcctgtctcagatacctgctggagcacgacgccgacgttaat
gccaccacagacttggggcagaccccgttgcacctggccgcctctgagggctttctcgac
tgtgcagagatcctcgtgaaggccggagcagatgttttggccaaggacagcttggggcag
acacctctggacttagcctgcatctggtgccacaggaaggtagcgaggtatctgaagagc
tgtatgtggcatgtgaataaagagaaagaaagaaaggagagagtgctggttcaggcctta
tacactgatcttgtgggcatggccaaacagaataatctcaccagaaagacactcactgat
gaaaaggtggctgagtgggcaaagaagaaaggcgtggccctcctgaaggatttctccctc
agggagcaggtgagcaagtatcacaccaagtgcttcttagcagatcagagcaactgtgag
tcaaagcatgcaaaggcccactgtgaggagcagcagcctgaaggcattaaagaggacagg
aacacccttcctaagccacccttcaaaccatggagcatcttcacaggcctccagccaaag
aaacccctcgcagaacccgacctccgtgacagcgtcaccatttggagggacagctccagc
aggcaacttcagtacaccaccaggtgggacagcacgcctcgccccgctcctaacctgcct
ctggatgtccttgagagggtgttgtttcccagagccttcccttccaggatcacctggcca
caggactttgagtcacagaacatggtggaggtcaagcatcaaggatgccctcaggagcac
aacacctccccctggacagaggtggccatgtgtctggttgaggtgctggagtttagacag
tactga

DBGET integrated database retrieval system