KEGG   Maylandia zebra (zebra mbuna): 101466738Help
Entry
101466738         CDS       T02814                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04270  Vascular smooth muscle contraction
mze04371  Apelin signaling pathway
mze04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101466738
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101466738
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101466738
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mze04147]
    101466738
   04031 GTP-binding proteins [BR:mze04031]
    101466738
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101466738
  Exosomal proteins of colorectal cancer cells
   101466738
GTP-binding proteins [BR:mze04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    101466738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA MMR_HSR1 Roc FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 101466738
NCBI-ProteinID: XP_004556735
UniProt: A0A3P9B8F9
Position
LG8
AA seq 377 aa AA seqDB search
MADFLPTRSVLKVCLPVCLLNSGEVEQLRKSKEIDRCLSKEKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQHAREDFRATIYSNVIKGIRVLVDAREKLHIPWGDEDNQPHGD
NLMAFDTRSAKMTSGQLETSVFLEYLPAIKALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGELDYLPTQQDILLARKPTKGIHEYDFEIKNVPFKMVDVGGQRSERRRWFECFDSV
TSILFLVSSSEYDQVLMEDRQTNRLRESLDIFETIVNNRVFNNVSIILFLNKTDLLEEKV
KNVPLKDYFPEYNGPEHSLPDVQAFMVDCFRAKRRDCTQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttcctgccgaccaggtccgtgttaaaagtttgtctacccgtctgcctgctt
aacagcggcgaggtggaacagctgagaaagtccaaagagatcgacagatgtctctccaag
gagaaaacgtatgtaaaacggctggtgaagatccttctcctcggcgctggcgagagcggc
aagtcgactttcctcaaacaaatgcggatcatccacggccaggacttcgaccagcacgcc
cgagaggatttcagagcaacgatttacagcaatgttatcaaaggtatacgtgtgctggtg
gacgcccgtgagaagctgcacattccgtggggtgatgaagacaaccagccgcacggcgac
aacctgatggcgttcgacacccgctcagccaagatgaccagtgggcagcttgagacatcg
gttttcctggagtacctgcccgccattaaggccctgtgggcagactcgggcatacagaac
gcctacgataggcgcagggagtttcagctgggtgagtcagtgaagtatttcttggataat
ctggataagctcggcgagctggattatcttcccactcaacaggacatcctgctggctcgt
aaacccactaagggcatccatgagtatgactttgagatcaagaatgttcccttcaagatg
gtggacgtgggagggcagcgatccgagcggagacgctggtttgagtgtttcgactcagtc
acctcgatcctcttcctcgtctcctcctccgaatatgaccaggtgctgatggaggacagg
cagaccaaccggctccgtgaatcgctcgacatcttcgagaccatcgtcaacaaccgtgtc
ttcaacaacgtttcgatcatcctattcctcaacaagacggatctgctggaggagaaagtg
aaaaacgttcccctcaaggactactttcccgagtacaacggaccggagcacagcctgccg
gacgtccaggcgttcatggtggactgcttccgggccaagaggcgcgactgtactcagaag
cccctgtaccaccacttcaccaccgccatcaacacggagaacatcaggctggtgtttcgg
gacgtcaaggacaccatcctgcacgacaacctcaaacagctcatgctccaatga

DBGET integrated database retrieval system