KEGG   Maylandia zebra (zebra mbuna): 101466870Help
Entry
101466870         CDS       T02814                                 

Definition
(RefSeq) cyclin-dependent kinase 11B isoform X1
  KO
K08818  cell division cycle 2-like [EC:2.7.11.22]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101466870
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mze03041]
    101466870
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101466870
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101466870
Spliceosome [BR:mze03041]
 Complex A
  Other components
   Complex A specific factors
    101466870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 101466870
NCBI-ProteinID: XP_004571045
Position
LG20
AA seq 817 aa AA seqDB search
MGDEKDTWKVKTLDEILLEKKRRKELQEKTDPKRQKNFSKGLASQADDREAKRDTPEEGE
LRDQRMEITIRNSPYARQDSMEDRGEEDESLAIKPPQQIARKDKSHHRKEEKRKDKRRHR
SHSAEGAGKHARLKDKEKERESDRRKRHWEEDKARRDWERQKRREQARAHSRRERPPVDS
AGFFLDHRDRLEQLERQRERDRKLWEQQKEQRELKDRERRAEERRKERGTRREVPSRMLP
EEYDDKPKQSHRSRSPVRVPRERSDHSETRKSGSSKEEKPESKDLLADLQDISDNERKTS
TAESSLASASVSEEEEDEEEDEEESSSQSEGEEEEEEESASGSGRSEQSAEDVSEDEQSG
EDFEQERENGNHIPAVPESRFDHDSEESGEDMEEEEEEEDEEEEEAGEGEPTPHSQTHSR
SATPEGNYIPESPPVSPVELKKELPKYLPAFQGCRSVEEFQCLNRIEEGTYGVVYRAKDK
KTDEIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNY
VEHDLKSLMETMKQPFLPGEVKTLMIQLLRGVRHLHDNWILHRDLKTSNLLLSHKGILKI
GDFGLAREYGSPLKPYTPVVVTLWYRSPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLF
PGKSEIDQINKIFKDLGSPSEKIWPGYSELPAVKKMTFTEYPYNNLRKRFGALLSDQGFD
LMNKFLTYCPSKRISSDEALKHEYFRESPLPIDSSMFPTWPAKSEQQRVKRGTSPRPPEG
GLGYSHLGDDDLRDTGFHLTTSYQGASAVGPGFSLKF
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgaaaaagacacctggaaagttaaaactcttgatgaaatcttactagagaag
aaacgcagaaaagaattacaagagaaaactgatccgaaacgccagaaaaatttctcaaag
ggccttgcttcacaggcggatgatcgggaagccaaacgagacactccggaggaaggagaa
cttcgggatcaaagaatggaaataacaattcgtaactcgccatatgcacgtcaagactca
atggaggacagaggggaagaagacgaatcactagcaattaagcctccacagcaaatagca
agaaaggacaaatctcaccacagaaaagaggagaagcgaaaagataaaagacgtcatcgc
agtcactcagctgaaggagcaggaaaacatgcacgactcaaagataaagaaaaagagcgc
gaaagcgatcgcaggaaacgtcactgggaagaggacaaagcccggcgagactgggaaagg
cagaaaagaagggaacaggccagagctcattcacgtagagagagacctccagtggactct
gctgggttttttttggatcacagggaccgactggagcagctcgagcgccagcgggagcgt
gaccgaaagctctgggaacagcagaaagagcaacgagagctaaaagaccgggagaggagg
gctgaagagcgacgcaaagaaagagggactcgacgagaagtgccatctcggatgctacct
gaggaatatgatgacaagccaaaacaaagtcaccgcagccgtagtccagtacgtgttccc
agagaaaggtctgatcacagtgaaacacggaaaagcggatcatcaaaagaagagaagcct
gagagcaaggatctgcttgctgatctgcaggatatcagtgataatgaaaggaagactagc
actgcagaatcctccctggcatcagcgtctgtttctgaggaagaggaagatgaggaggaa
gatgaagaagagtccagcagccagagtgagggtgaagaagaagaagaggaggaatctgct
tcaggctcagggcggtctgagcagagtgcagaagacgtgagtgaggacgagcagtctggg
gaagattttgaacaggagagggaaaatggaaatcacatacctgcagtaccagagtcccgt
tttgaccatgactcagaagagagtggtgaggacatggaggaggaggaggaggaggaagat
gaggaggaagaagaagcaggagagggggaacccacccctcactctcaaactcattcccgt
tcagccactccagaagggaactacatcccagagtctcccccagtctcacctgtggagctg
aagaaggagctgcccaaatatctgccggcttttcagggttgccgcagtgttgaggaattt
cagtgtttgaatcgcatagaggagggaacctacggcgtggtgtacagagccaaggacaaa
aagaccgatgagattgttgcgctgaaaaggctgaagatggagaaggagaaggagggcttt
cccatcacatctttaagagaaatcaatacaattctcaaagctcaacatccaaacattgtc
acagtaagggaaatagttgttggaagcaatatggacaagatctacattgtgatgaactat
gtagaacatgatctgaagagtctgatggaaacaatgaagcagcccttcctgccaggagaa
gtaaagactctgatgattcagttgctccgaggagtccgacacctccacgataattggatt
cttcaccgtgatctgaagacgtccaatttgctgctgagccacaagggtattctcaagatt
ggtgactttggtttggcccgggagtacggttcccccctgaagccttacaccccggtggtg
gttaccctgtggtacagatcgcctgagctgctgcttggagccaaggaatactccacagct
gtggacatgtggtcagtgggctgcatatttggcgagcttctcacccagaagcctctcttc
cctggaaaatctgaaattgaccaaattaacaagattttcaaggatctagggtcgcccagc
gagaagatctggcccggctacagcgagctgcccgctgtgaagaagatgactttcacagaa
tacccctacaacaacctgcgaaagcgctttggagcactgctgtcagaccaaggctttgac
ctcatgaacaagttcctcacctactgccccagtaagaggatttcatcagatgaggctctc
aaacatgagtacttcagggagtctcctctccccattgactcctcgatgttccccacctgg
ccggctaagagcgagcagcagagggtgaagcgaggcaccagtcctcgtccacccgaggga
ggcctgggctacagtcacctgggcgatgatgacctgagagatactggcttccacctgaca
accagctatcagggggcatctgcagtcggtccaggattcagcctcaagttctga

DBGET integrated database retrieval system