KEGG   Maylandia zebra (zebra mbuna): 101467007
Entry
101467007         CDS       T02814                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00100  Steroid biosynthesis
mze01100  Metabolic pathways
Module
mze_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    101467007 (tm7sf2)
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     101467007 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT DUF4083
Other DBs
NCBI-GeneID: 101467007
NCBI-ProteinID: XP_004557358
UniProt: A0A3P9C7P3
Position
LG10
AA seq 425 aa
MRPNSQALKHKLSHDSEREFGGTLGAVCIPIFLPLTVLFLICLSRSPEASLFQWPPPLPS
ADQLWDPLAPVLLLGWFALHAVIYLMPLGKVSEGLVLRDGTRLKYPINGFHGLCISGVFL
MLLLGLGAPLGYLFELLLPLAVCAIAVSFLFSIYLYIRSFWAPSHALALGGNTGNPLYDF
FIGRELNPRIGDFDLKYFCELRPGLIGWVVINLGMLMKEVELRGSPSLAMILVNSFQLLY
VADALWNEEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYGLQAAFLVVHPQTLSSLKAAAI
IALNGIGYYIFRQSNSQKNQFRRDPTHPSVTRLETIATATGKRLLVSGWWGLVRHPNYLG
DLLMALAWSLPCGFSYLLPYFYVIYFTVLLIHREARDERQCRAKYGLAWDTYCRRVPYRI
FPYIY
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgagaccaaacagtcaagcactcaaacacaaactgtcacatgactcagagagggaattt
ggaggaaccctgggtgccgtgtgcattcccatctttcttccgttaacggtgctgttcctg
atctgtttgagccgatctcctgaggccagtttgttccaatggccgccccccctcccctca
gctgaccagctgtgggacccgctggcccccgtgcttcttcttgggtggtttgctttgcat
gcagtcatctatttgatgccattaggaaaggtgtctgaggggctggtgctcagagatgga
acacgcctcaagtatcccataaatggttttcatggcctgtgcatcagcggtgtgttcctg
atgttgttactggggctcggggctcctctggggtatctgtttgagctgctgttgcctttg
gcagtatgtgcaatagcagtgtcgttcctgttctccatctacctctacatccgctccttc
tgggctccttcccatgcgcttgctttggggggaaacacaggaaacccgctctatgacttc
ttcatcgggcgggagctaaacccccggattggagattttgacctgaaatatttctgcgag
ctcagaccgggcctgattggctgggtggtcattaacctcggcatgctgatgaaggaggtg
gagctccgaggatccccctcccttgccatgattctggtcaacagtttccagctgctgtac
gtggcggacgctctgtggaatgaggaggctgtcctgaccaccatggacattgtacacgat
ggttttggtttcatgctggtctttggtgatctggcctgggttccattcacgtacggcctg
caggcagccttcctggttgtgcacccccagaccctaagttcactcaaggctgcagccata
atagcactgaatggtattggatattacattttcagacaatccaactcacagaagaatcag
ttcaggcgggaccccactcatccaagtgtcactagactggagaccattgccacagcaaca
gggaagcggctgctggtgtccggctggtggggtctcgttcgtcatcccaattaccttggg
gacctcctcatggcccttgcctggtcccttccgtgtggattctcatatcttctgccttat
ttctacgtcatatacttcaccgttttactgattcaccgagaggcccgtgatgaaagacag
tgtagagccaaatacgggctggcttgggacacatactgccgacgtgtgccttacaggatt
ttcccttatatatactaa

DBGET integrated database retrieval system