KEGG   Maylandia zebra (zebra mbuna): 101467156Help
Entry
101467156         CDS       T02814                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00020  Citrate cycle (TCA cycle)
mze00190  Oxidative phosphorylation
mze01100  Metabolic pathways
mze01200  Carbon metabolism
Module
mze_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mze_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mze_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101467156
  Energy metabolism
   00190 Oxidative phosphorylation
    101467156
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101467156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 101467156
NCBI-ProteinID: XP_004544823
Position
LG5
AA seq 283 aa AA seqDB search
MSVASFTSLTRCGVLAFRSPAGLLAVRYAQTAAAPAGQPRVKKFQVYRWDPETPGDKPRM
QTYEIDLNTCGPMVLDVLIKIKNEIDPTLTFRRSCREGICGSCAMNINGGNTLACLNKID
SSLSKPTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESKEGKEQYLQSVEDRE
KLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEYTEERLSKLQDPF
SLYRCHTIMNCTKTCPKGLNPGKAIAEIKKMMATYKKKTAAAV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcgccagttttacgtccttgactcggtgcggtgttttggcattccgctctccc
gcaggactcttggcggtacggtatgcacagacagcagcagctccagcagggcagcccagg
gtaaagaagttccaggtgtacagatgggatccagaaactccaggggacaaaccccgaatg
cagacctatgagattgacctcaacacctgtggcccaatggttctcgatgtgctcattaag
atcaagaatgagattgaccccactctgacatttcgtcgctcctgcagagaaggtatttgt
gggtcctgtgcaatgaacatcaatggaggaaacacactcgcctgcctcaacaagatcgac
tccagcctcagcaagccgactaagatttaccctctgccacacatgtacgtcgtcaaggac
ctggtacctgacatgagtaacttctacgcccagtacaagtccatcgaaccctacctgaag
aagaaggatgagtccaaggaagggaaggaacagtacctgcagtctgtggaggaccgggag
aagctggacgggctgtatgagtgtattctgtgcgcctgttgcagcaccagctgcccaagt
tactggtggaacggagacaaatacctcgggcctgctgtgctcatgcaggcgtaccgctgg
atgattgactcacgagacgagtacacagaagaacggttgtccaagctgcaggatcctttc
tcgctctaccgttgccacaccatcatgaactgcaccaagacctgtcccaagggcctgaac
ccaggaaaagctatcgctgagatcaagaagatgatggccacatacaagaagaagacagca
gctgctgtctga

DBGET integrated database retrieval system