KEGG   Maylandia zebra (zebra mbuna): 101467628Help
Entry
101467628         CDS       T02814                                 

Definition
(RefSeq) leukotriene B4 receptor 1
  KO
K04296  leukotriene B4 receptor 1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101467628
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mze04030]
    101467628
G protein-coupled receptors [BR:mze04030]
 Rhodopsin family
  Lipid
   Leukotriene
    101467628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx Renin_r
Motif
Other DBs
NCBI-GeneID: 101467628
NCBI-ProteinID: XP_004539611
Position
LG1
AA seq 363 aa AA seqDB search
MNNTYQLSSQEEMAPSEFDGGTVVSCVILGLSFLAGAPGNLLVIWTILRHVEKRSHTVVI
ILHLAVADLLVLITLPLWIYSLAHSWIFGVVSCKAMVFMINTCMYSSVFLITLMSVERFV
AVRYPFASAHWKRKQALNKVLLVLWIAALLFSIPVIPTQIVDKDSGKDSCLYREYTSVTQ
ELVCVLLETLVGYIIPFSILVVCYGCLCSRITRMTLKSKRKSTILIANVVVAFGICWTPH
HIGNILSLIILGTENSYKDVAEHLENVRTTMVFVTGAMAFISSTVNPILYMFAARSFRSS
LRDTGIQKLFRHISSTSPGEGNREVSYVSKRPSNQTSTSHVLSESKDQIGVLMTMCENNP
SGQ
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacacataccagctgtcttctcaagaggaaatggccccttcagagtttgatggt
gggacagtggtgtcgtgtgtgatccttggtttgtccttcctggctggagctcctgggaac
ctgctggtgatctggaccatcctgagacatgttgaaaagcgctctcacacagtggtgatt
attctacacctggctgttgcggacctgcttgtcctcatcaccctgcctctgtggatctac
tctctggcccactcctggatatttggggtggtatcttgcaaagccatggtgttcatgatc
aacacgtgtatgtacagcagcgttttcctcatcaccctcatgagcgtggagcgttttgtg
gctgtgcgatatccctttgcttcagctcactggaagaggaaacaagctctaaataaagta
ctgctggttctgtggattgcagcactcttgttcagcatacctgtcatcccaactcagatt
gttgacaaagattctggtaaggatagctgcctgtaccgtgaatatacttcggtgacccag
gaactggtgtgtgtcttgttagagacactggttggctacataatacccttctccatcctt
gtggtctgctatggctgcctctgcagccggattactcggatgactctcaaatccaaacgc
aagtccaccatcctgatcgccaatgtcgtggttgcatttggcatttgctggacacctcat
cacataggaaatatcctctcgctgatcatcctgggaactgaaaactcctacaaggatgta
gcagaacatttggaaaacgtgaggaccactatggtttttgtcactggagccatggccttt
atcagcagcacagttaaccccatcctctacatgtttgcagctcgctccttcaggagctcc
ctccgtgacacgggcatccagaagctcttccgccacatctcgagcacctccccaggtgag
ggcaacagggaggtgtcctatgtgtccaagagacccagcaatcagaccagcacctctcat
gtgctatctgagtcaaaagatcaaataggtgtgttgatgacaatgtgtgaaaacaatcca
tctgggcagtga

DBGET integrated database retrieval system