KEGG   Maylandia zebra (zebra mbuna): 101468114
Entry
101468114         CDS       T02814                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101468114 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mze03000]
    101468114 (mecom)
Transcription factors [BR:mze03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    101468114 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED PyrI_C
Other DBs
NCBI-GeneID: 101468114
NCBI-ProteinID: XP_004561435
Position
Unknown
AA seq 1271 aa
MRSKGRARKLATSDGDDKIPLYPSDILDDVCGSDGDPTPSSALPEDPGSPSLSDDESSPQ
DHLSFQHQSIFFPQEDLSIPFDFELRESTVPSGGLGIWSRRKVNVGERFGPYEGEHRPCL
QDPTQGWEILDGSGHVKFCVDASKPDIGSWLKHIQFAPAAKQHNLTACQIDDQIFYKVTR
EIFPGQELLLFMKAEEYSCDTMAPDIHEERQYRCEDCDQHFESRNQLLDHQKKPCGMPPS
SFLNPGGDNDLKAQEPQDLRPLHMSQGLHECKECDQVFPDVQSLEAHSLSHSEEREYKCD
QCPKAFNWKSNLIRHQMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSEC
GKTFATSSGLKQHKHIHSSVKPFMCKSLRPYLCEVCHKSYTQFSNLCRHKRMHADCRTQI
KCKDCGQMFSTTSSLNKHRRFCEGKNHFTAGGLFAQGMPLPGAPGLDKSALAMGHSSAGL
ADYFGASRHHSGLTFPAAPAFPFSFPGLFPSGLYHRPPLIPATTSPVRQPSHAPVAGPGV
ELSKSPLLPPSPGAQESQELLKALRKDGGSPGSQMPVSDSQGSSYTKQKNKQSDQSESSD
LDDVSTPSGSDLESTSGSELESDMDSERERGAARENGKGPKRKASEGGPQSPGLMGSSAA
KDFPGPSLIPSPLDEHTAVTGAVNDSIKAIASIAEKYFGSTGLAGLQDKKVGSLPYPSMF
PLPFFPAFSPPVYPFPDRDLRTAGLKGEPQSPADDCKKAQGKSSSESPFDLTTKRKEEKL
ASFASSKPEMAQSMGQDQPLDLSLGARGRGRNPREEETKKNPNYEEEKGVVEIPKADTSL
QHARPTPFFMDPIYSRVEKRRMSDPFETLKDKYMRPAPGFLFHPQFHLPDQRTWMTAIEN
MAEKLETFGSLKPEPGDLLRSVPSMFDFRAPPSALPDTLLRKGKERYTCRYCGKIFPRSA
NLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLD
RHLKKHENGNLSGTAMSSPQSELDSSSAILDDKEDSYFNEIRNFISNTSQNQTSPDPSEE
GLNGGPFEEEKPLMASHRSHDLEDEEAEELGADEEEGEEPSNTPEKSESKVLQSDLDDPI
IQDEMDLSEPNDLNLSCKTSPRRYKDEEEQSSYSALDHIHRFTEMRKLDESELSDGDGDG
DEEDGSFGSPSLTEAVKQPLFRKSKSQAYAMMLSLAEKDTLHPATHTPATMWHSLARAAA
ESSAIQSLSHV
NT seq 3816 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcacggaaactggccacgagtgacggagatgataagatacct
ctttatccatccgacatcttagacgacgtatgcggctctgatggggatcctacaccttct
tcggccctgccagaagacccgggatcaccttcactctctgacgatgagtcctctccacag
gaccatctgtcattccaacaccaaagcatctttttcccccaagaagatctgagcattccc
tttgactttgaattgcgagagtcaaccgtcccatctggagggctgggcatctggagccgc
aggaaggtgaacgtcggggagcgatttggaccatatgaaggagagcacaggccttgtctc
caagatcctactcaaggctgggagatcttggatgggtcaggccatgtaaaattctgcgtg
gatgccagcaaaccagatatcgggagctggctgaagcacatccagtttgcccctgcagcc
aagcagcacaacctgacagcgtgccagatagatgatcagatattctacaaagtcaccaga
gagatttttcctggccaggagctgctacttttcatgaaggctgaagagtattcatgtgat
acgatggctcctgatattcatgaggagaggcagtaccgctgtgaggattgtgaccagcac
tttgagtcccgaaaccagctgctggaccaccagaagaagccgtgtgggatgcccccctcc
tccttcctgaacccaggaggcgacaatgacctgaaagcccaagaacctcaagacttgcga
cccctccacatgtcccaaggactacacgaatgtaaagagtgtgaccaggtcttccctgat
gttcagagcctggaggcccacagcttgtcccacagtgaggagagagaatataagtgtgac
cagtgtcccaaggccttcaactggaaatcgaacctgatccggcatcagatgtcgcacgac
agtggcaagcactacgaatgtgaaaactgctcaaagcaggtgttcacagaccccagtaac
ctccaaaggcacattcgctcgcagcacgtcggggcgcgtgctcatgcctgttctgagtgt
ggcaagacgtttgcaacgtcttcaggcctcaaacagcataagcacatccacagcagtgtc
aagcccttcatgtgtaagtcactaagaccctacctatgtgaagtctgccacaagtcctac
acccagttctctaacctttgccgccacaaacgtatgcacgctgactgccgcacacagatc
aaatgtaaggactgtgggcaaatgttcagcaccacctcttccctcaacaagcaccggcgc
ttctgtgaagggaagaaccacttcacagcaggagggctgtttgcccagggtatgccactc
cctggggcccccggcttggacaaatcagctcttgcaatgggtcacagcagtgcaggactt
gctgattattttggggctagccgacatcacagcggacttacgttccctgctgccccagca
tttcctttcagcttccctggcctgttcccctctggactttatcaccggccgccactcatt
cctgccacaacttctcctgtcagacagccatcccacgcacctgttgctggacctggagta
gagctgagcaagagtcctttgctgcctccaagccctggtgctcaggagtctcaagaactt
ctcaaagctctccgcaaagacggcggttcacctggaagtcaaatgccagtgtcagacagc
cagggctcatcctataccaagcaaaagaacaagcagagtgaccagtctgaaagcagcgac
ctggatgatgtcagcacacccagtggaagtgatctagagagcacgtcaggctccgagctc
gaaagcgacatggacagtgagagggagaggggggctgctagagaaaacggaaaaggtcca
aagaggaaggccagtgaaggaggccctcaaagccccggcctgatgggcagcagcgctgct
aaagactttccaggcccttccctcatcccgtccccgctggacgaacacacagctgtaaca
ggagctgtgaatgactctattaaggccattgcctcaattgccgagaagtattttggctcc
actgggctagctggcctacaggacaagaaggttgggtctcttccctatccttctatgttt
ccactgcctttcttcccagcgttctcccctccggtttaccccttcccagacagagacctc
agaactgcaggcctgaagggggagccacaatcacctgcagatgactgcaagaaggcccaa
gggaagtcttcatccgagtccccatttgacctcaccaccaagcgaaaggaggaaaagtta
gcatcctttgcatcttccaaaccagaaatggcccaatctatgggtcaggatcagccacta
gatttgagccttggggccaggggccgtgggcgtaatccaagagaggaggagacgaaaaag
aatccaaattacgaagaggagaaaggagtggtggagatcccaaaagcagacacttcctta
caacatgctaggcccacccctttcttcatggaccccatctatagcagggttgagaagagg
agaatgagcgatccgtttgagactctgaaagacaagtacatgcgacccgctccgggcttc
cttttccatccacagtttcatttgccagatcagagaacttggatgactgcaatcgagaac
atggcagagaagctggaaacgtttggctccttgaagccagagcctggtgacctgctgcgc
tcggttccctccatgtttgacttcagagctccgccctcggcgcttcccgacacgctactg
cgcaagggaaaggagcgctacacatgcagatactgtggaaaaatattccctcgctctgcc
aatctgacacgccacctgaggactcacacaggagagcaaccgtataggtgtaagtactgt
gaccgctccttcagcatctcctccaacctacagcgtcacattcgcaacatccacaacaag
gagaagccgtttaagtgccacctgtgcgaccgctgcttcggtcagcagacaaacctggat
cgccacctcaaaaagcacgagaacggcaatctgtcaggaactgcaatgtcgtccccacag
tctgaactggacagcagcagcgccatactggatgacaaagaggactcttatttcaacgaa
ataagaaattttatcagcaacacaagccagaaccagacatcaccggacccctcagaggaa
gggctaaatggcggtccatttgaagaagaaaagccactgatggccagccataggtcacat
gacctggaagatgaggaagcggaagagttaggtgcggatgaagaagaaggggaggagcct
agcaacacccctgaaaaatcagaaagcaaggtgctccaaagcgacctcgatgatcccatc
atacaagacgaaatggacttgagtgagccaaatgacttgaatctcagctgtaaaacttct
ccaaggaggtataaagacgaggaggagcagagcagctactcagccttggatcacatccat
cgctttactgaaatgcgcaagctggacgagagcgaactgagtgacggagatggggatggg
gatgaggaggacggctcatttggttccccatctctgactgaggcagtcaaacagccgctc
tttaggaaatcaaagtctcaggcttatgccatgatgctgtccctggctgaaaaggacact
cttcacccagctacccacaccccagccaccatgtggcacagtctggcacgggctgccgct
gaatccagtgccatccaatccctcagccatgtatga

DBGET integrated database retrieval system