KEGG   Maylandia zebra (zebra mbuna): 101469094Help
Entry
101469094         CDS       T02814                                 

Gene name
acsbg2
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase ACSBG2
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00061  Fatty acid biosynthesis
mze00071  Fatty acid degradation
mze01100  Metabolic pathways
mze01212  Fatty acid metabolism
mze03320  PPAR signaling pathway
mze04920  Adipocytokine signaling pathway
Module
mze_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101469094 (acsbg2)
   00071 Fatty acid degradation
    101469094 (acsbg2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101469094 (acsbg2)
   03320 PPAR signaling pathway
    101469094 (acsbg2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mze01004]
    101469094 (acsbg2)
Enzymes [BR:mze01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     101469094 (acsbg2)
Lipid biosynthesis proteins [BR:mze01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101469094 (acsbg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 101469094
NCBI-ProteinID: XP_004553871
UniProt: A0A3P9CUL9
Position
LG17
AA seq 764 aa AA seqDB search
MQLTLCESTSMSGVTEPPREVGFLESPCVTVDSAASLDDGIVDTANESSEEESAGEREEE
TGAHDAATSSTKTTEVPAEQSSNTPAVSAQRPDSLSVPAAEPRLWTTQRDGEVKLRMEES
GLAAEPALTVNQMFVSTVERYGEYTALCWKEGDQQKSLKYKDYYQTCRTAAKSFLKLGLE
RYHGVGILGFNSVEWFVADIGAILAGGFAVGIYTTNSPEACQYVAENSKANIIVVENHKQ
LQKILQIEDQLPHLKAIVQYKDELKEKRPNLYTWAEFLELGRDEPDAPLDAIIASQKPNQ
CCSLIYTSGTTGQPKGVMLSHDNLTWTAYSTAKHVSLTAASQAQEVVVSYLPLSHIAAQM
VDIWIAMKIGGVTYFAQPDALKGSLVDTLKEARPTAFMGVPRVWEKMQEKMKAVGAKSST
VRRKVAAWAKDVGLRTNLSKLNQNSAPGSAPVSYHVAKKLVFKKVRKALGLDRCTKCYTG
AAPITKDTLEFFLSLNIPLCELYGMSESSGPHTISRHDAFKLTSCGIELPGCKTKLHNKD
EEGNGEICFWGRHVFMGYLNMPDKTEEALDAEGWLHSGDLGKQDENGFLFITGRIKELII
TAGGENIPPVPIEDAVKEAVPLISNAMLVGDKRKFLSMLLTIKCQVNPDTGDPQDELTPE
AVELCRQLGSKATRVSEISGGRDPAVNAAIQEGIKRVNEKSTSNAQRIQKWVVLDRDFSV
GGGELGPTMKLKRPVVMKMYKEQIDNCYKDVASPATPDNPLPPK
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaactttgtgcgagtccaccagcatgtcaggggtgacggagcctcccagagaa
gtcggtttcctggagtcgccctgtgttacagtggacagcgcggcctccctcgatgacggc
atcgtggacacagcaaatgagtcttcagaggaagagtccgcaggggaaagggaagaggag
accggcgcccatgacgcagccaccagcagcaccaagactacagaggtccccgcggagcag
agctcaaacacaccagcagtgagcgcccagcgcccagactccctgtcggtgccagcagca
gaaccccgtctgtggacgacgcagcgcgatggagaggtgaagctgaggatggaggagtcc
ggtctggccgctgaacccgctttgacggtcaaccagatgttcgtctcgaccgtggagcgc
tacggcgaatatacggctctgtgctggaaggagggcgaccagcagaaaagcctgaaatac
aaagattactaccagacctgccgcaccgctgccaagagcttcctgaagctcggactggag
cgttaccacggcgttgggatcttgggcttcaactccgttgagtggttcgtcgcagacatc
ggagccattttggcgggtgggtttgctgtgggcatctacaccaccaactctcctgaggcg
tgccagtatgtagcagaaaactccaaggccaatatcatcgtggtggagaaccacaaacag
ctgcagaagatccttcagatcgaagaccagctgccacacttgaaagccatcgtccagtac
aaagacgaactaaaagagaagagaccaaacctgtacacgtgggccgagttcttggagctt
ggacgcgacgagcccgacgctcccctcgatgccatcatcgccagccagaagcccaaccag
tgctgctcgctcatttacacctcagggaccacgggccagcccaaaggagtcatgctcagc
cacgacaacctaacctggaccgcttactccaccgccaagcatgtgagtctcaccgcggcc
tcccaggctcaggaggtggtggtcagctacctgcctctgagccacatcgcggcccagatg
gtcgacatctggatcgccatgaagatcggaggggtgacttactttgctcagcccgacgcc
ctgaagggttcgctggtagacactttgaaggaggcgcgtccgacggccttcatgggcgtc
ccacgtgtctgggagaagatgcaggagaagatgaaagctgttggagcaaagtcttccacc
gtgcgaaggaaagtggctgcctgggccaaagacgtgggtctgcggaccaatctgagcaag
ctcaaccagaattcagcaccaggcagcgctccggtcagctatcacgtagccaaaaagctt
gtgttcaaaaaggtgcgtaaggccctgggcctggaccgctgcaccaagtgctacacaggc
gccgcccccatcaccaaagacaccctggagttcttcctcagcctcaacattcctctttgc
gaactgtacggcatgagcgagagcagcggccctcacaccatctcccgccacgatgccttc
aagctcaccagctgcggtatcgagctcccagggtgcaaaacaaagctgcacaacaaagac
gaggagggaaacggcgagatctgcttctggggacgccacgtctttatgggttacctcaat
atgcccgacaagacagaggaggcgctggacgcggagggctggctgcactcgggtgacctg
ggcaagcaagacgagaacgggttcctcttcatcaccgggcggattaaagagctgatcatc
acagccggcggcgagaacatccctcccgtccccatagaggatgcggtgaaggaggccgtg
ccgctgattagcaacgccatgctggtcggagacaagaggaagtttctgtccatgctgctc
accatcaagtgccaagtgaacccagacacgggcgatccacaggacgagctgacgccagaa
gctgtggagttgtgcaggcagctgggcagcaaggccacgcgcgtctccgagatctcaggc
ggacgagaccctgcggtcaacgctgccatccaggagggcatcaaaagagtcaacgagaag
tccacctccaacgctcagcgcattcagaagtgggtcgtcctggatcgagacttctctgtc
ggcggaggagagctgggccccaccatgaagctgaagcggccggtggtgatgaagatgtac
aaggagcagatcgataactgttacaaggacgtggcgtctccagcaacccccgacaacccg
ctgccacccaaatag

DBGET integrated database retrieval system