KEGG   Maylandia zebra (zebra mbuna): 101469827Help
Entry
101469827         CDS       T02814                                 

Gene name
dpp3
Definition
(RefSeq) dipeptidyl peptidase 3
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mze01002]
    101469827 (dpp3)
Enzymes [BR:mze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     101469827 (dpp3)
Peptidases and inhibitors [BR:mze01002]
 Metallo peptidases
  Family M49: dipeptidyl-peptidase III family
   101469827 (dpp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 101469827
NCBI-ProteinID: XP_004550359
UniProt: A0A3P9AUT6
Position
LG10
AA seq 726 aa AA seqDB search
MVDSQYYLPNDIGISALDCSEAFRLLSPQEKMYAHYLSRASWYGGLVVLLQTSPESANIF
VLLQRIFRKQTPAQLEQVATAAGLSSEEYQAFLVYAAGLYANMGNYKSFGDTKFIPNLPK
DKLKALVWASQAFQEQPAEMEALWDSCSCLLYSLENRQKQLGLGDKGITTYFSGNCCLED
AELAQKFLDSKKLSAYNTRLFKKEDGGKACYEVRLASAVQKDCAVDGECESCCGSFSFED
KEFTVKRGDYSRVMEKVCYYLEKAQAYAANENQRKMLEEYTRSFTLGSIDAHKEGSRYWI
KDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSERFAKLVSSAEVLLPELPWPQ
EFEKDTFLKPDFTSLDVLTFAGSGIPAGINIPNYDDIRQTEGFKNVSLGNVLAVAYATQK
EKLTFLEEGDKDLFIKWKGPSFEVQVGLHELLGHGSGKLFVQDDMGKFNFDQSKVINPET
GEPVSSWYRGSETWDSKFSTIASSYEECRAECVGLYLCLNKQVLSIFGHEGQDADDVVYI
NWLSMVRAGLLGLEFYTPESKRWRQAHMQARFVILRVLLEAGEGLVGLEEVTGEDGKPDA
QITLDRSKIPTVGKNAIHRFLCKLQVFKSTADVEGGRAFYDKYSTVSDTGAHNFLRLRET
VLLRKEARKMFVQANTRISGDSVELVEYEGSAAGLIRSFTERFQDDAEQLESGLLELSKQ
DAPCWC
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggtggactcccagtactacctcccaaatgacattggaatctccgcactcgactgcagc
gaggcctttcgtttgctttcacctcaggagaagatgtacgcccactacctgtcacgcgca
tcttggtatggcggtctggtagtactgctgcagacgtcccccgagtctgcaaacatcttt
gtcttgctgcagagaatcttcaggaagcagacgcctgcacagctggaacaggtcgccaca
gcagctgggctcagctctgaggagtatcaggcctttctggtgtatgcagcaggtctgtat
gcaaacatgggcaactacaagtcttttggagacacaaagttcatcccaaatctgcctaag
gacaagctgaaagcgctggtttgggccagccaggcctttcaggagcagccggctgagatg
gaggctctgtgggacagctgctcctgtctcctctactcgctggaaaacagacagaaacag
ctggggctgggcgacaagggaattaccacctatttctcaggaaactgctgcctggaggat
gctgagctggctcagaagttcctcgactcaaaaaaactgtctgcctacaacacgcgtctg
tttaagaaggaagacggagggaaagcctgctatgaggtccgcttggcttcagctgtgcaa
aaagactgcgcagtggatggggagtgcgagtcctgctgtggcagcttcagctttgaagac
aaagagttcactgtgaagaggggagactatagccgtgtcatggaaaaagtctgctattat
cttgaaaaagcacaggcctatgctgccaatgagaaccagaggaagatgcttgaagagtac
acacgcagcttcaccttaggctccattgacgcacataaagagggttcgcgctactggatt
aaagacaaggggccaattgtggagagttatataggtttcatcgagagctacagagaccca
tttggctccagaggagagtttgaaggttttgtggccgttgtgaacaaggcgatgagtgag
cgtttcgccaaactggtgagttcagcagaagtcttgcttcctgagttgccttggccgcag
gagtttgagaaggatacgttccttaaaccggacttcacctcactggacgttctcaccttc
gctgggagtggaataccagctggcatcaacatccccaactacgatgacatcagacagaca
gagggctttaaaaacgtgtcgcttggtaacgtgctggctgtagcctatgcaacgcaaaag
gaaaaactgaccttcctggaggagggtgacaaggatttgtttatcaaatggaagggcccg
tcgttcgaagtgcaggttggacttcacgagcttctgggtcacgggagcggaaagctgttt
gtccaggatgacatgggcaagtttaactttgaccaaagtaaggtgatcaacccagagacc
ggtgaaccggtgtccagctggtatcggggcagcgagacctgggacagtaagttctccacg
attgcttcttcttatgaagaatgccgcgctgagtgtgtcggactctatttgtgcctcaac
aaacaagtgctcagtatttttggccatgagggtcaggatgcagatgatgtggtgtacata
aactggctcagcatggtgagagcgggactgctgggcctggagttctacacacctgagagc
aagcgctggagacaggctcacatgcaggctcgattcgtcatcctacgcgtgctgctggag
gctggagagggcctggtgggcctggaggaagtaacgggagaagatggcaagcccgatgca
caaattacactggaccgaagcaagatccccaccgtgggcaagaacgccatccataggttc
ctttgtaaactgcaggtctttaagtcgacggcagacgtggaaggaggcagggctttctat
gacaagtactccactgtaagcgacactggcgctcacaactttttgcgcctgcgcgagacg
gtgctgctgaggaaggaggctcgcaagatgtttgttcaagccaacacaagaatcagcggg
gatagtgttgagctggtggaatacgaaggcagcgcagcaggtttgattcgttcctttacc
gagcgcttccaagacgatgcagagcagctggagtccggcctgctggagctgagcaaacaa
gacgctccctgctggtgttga

DBGET integrated database retrieval system