KEGG   Maylandia zebra (zebra mbuna): 101470425Help
Entry
101470425         CDS       T02814                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00561  Glycerolipid metabolism
mze01100  Metabolic pathways
Module
mze_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    101470425
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mze01002]
    101470425
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101470425
Peptidases [BR:mze01002]
 Serine Peptidases
  Family S33
   101470425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Peptidase_S9 DLH PGAP1 DUF1057 Abhydrolase_5 Thioesterase LIDHydrolase Abhydrolase_2 Abhydrolase_3 Ser_hydrolase DUF1350
Motif
Other DBs
NCBI-GeneID: 101470425
NCBI-ProteinID: XP_024655275
Position
Unknown
AA seq 347 aa AA seqDB search
MPEPGAAPRRSPXGVPYSDLPHIVNADGLHLFCRYWEPTGQPRSVKRQLNVWLRSLCVSL
STVNGIIVHVRKASNPDSSGILVCERVALYLCPWSWEHCGPYDEMHRTEKLLAGIAHDHV
GHGQSEGDRMNIKDFQIYIRDSLQHIDLMKSHHPDLPVFIVGHSMGGAISILTACERPGD
FVGVVLIAPLVQMNPESATPFKVFMAKLLNHMLPSLTMGSIESKWLSRDKRQVEAYDADE
LNYHGGMRVSFGMQLMAAVERMQREIPSISWPFLLLHGDADKLCDIRGSRMMYDNSPSTD
KKIKIYEGGYHALHHDLPEVAESVLKELTTWITEHIPAATSQEAQGS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagccgggagctgctccgcggcgaagtccgncaggagtcccctactctgacctg
ccgcacatcgtcaacgcagacggattgcacctgttctgccgctactgggaacccaccggt
cagccaaggtcagtgaaacggcaactaaatgtgtggctgcgttccctctgtgtgtccctt
tcaacagtgaacggcatcatagttcatgtgcgaaaggcctcaaatcctgactcatccggc
attctggtgtgtgaaagagtggctctgtatttatgcccatggagctgggaacattgtggc
ccatatgatgagatgcacagaactgaaaaactccttgctggtattgcacacgaccacgtt
ggccatggccagagcgaaggtgacaggatgaacattaaggactttcagatttatatcaga
gactcccttcagcacattgacctgatgaagtctcaccaccctgacctacctgtatttatt
gtaggccactccatgggtggtgctatctcaatcctgacagcctgtgaaagacctggtgat
tttgttggagtggttctgatagctcccctggtccagatgaacccggagtcagccacacca
ttcaaggttttcatggcaaaactgctgaaccacatgctgcccagcctcactatgggctcc
atcgagtccaaatggctctcacgggacaagaggcaggtggaggcatatgacgctgatgag
ctaaactatcacggcgggatgcgagtatcattcggcatgcagctgatggcggcagtggag
cgtatgcagagggagatcccgtccatcagctggcccttcctgctccttcacggtgacgcc
gacaaactctgtgacatcagaggctccaggatgatgtatgacaattcaccgagtacagac
aagaaaatcaagatctacgaaggaggctaccacgctcttcaccatgacctccctgaggtg
gctgagtccgtgctaaaggagctgaccacctggatcacagagcacatcccagctgcaaca
tcgcaggaagcgcaaggctcctaa

DBGET integrated database retrieval system