KEGG   Maylandia zebra (zebra mbuna): 101470434Help
Entry
101470434         CDS       T02814                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate receptor 1
  KO
K05197  glutamate receptor 1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101470434
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mze04040]
    101470434
Ion channels [BR:mze04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   101470434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 DUF2061
Motif
Other DBs
NCBI-GeneID: 101470434
NCBI-ProteinID: XP_024659670
Position
LG10
AA seq 997 aa AA seqDB search
MLEKREGLRDTHTQRSATGGRECARGLRSVSPVSCEWDYGGSSGTAGGTMRPQSCPLPSA
LLPLLLGLCSGTSFPTNINIGGLFPGDSHEYEVFRFALAQNQDIPKLVPQVDMVDTSSSF
AMTYAFCSQFSKGVYAIMGLYDRRTVNMLMSFCGSLHVCFVTPSFPVQTNNQFVLQLRPQ
LQEPLMALLEHFYWTRFVYMYSSESGLAVLQRILDTAAERSWQVTSVNLDSLTEPAFIKL
LADLDYKKDFQIIIDCELKRLNYILNLIAAQKRNLKNYHYILANLGFLDLNVTEFQKLGP
NVTGFQLVNRSDPAVQKINQNWLDFDNKDLKVARRRLKYTGALTYDGVSVMATAFQNLRR
QRIDISRRGNAGECLANPPAPWXQGIDIQRALQQVRLEGLTGHVQFDERGHRTNYTLTVM
ELSHIGPRKIGFWNEKRGYVNTAIYKPMQEEFYNVQNKTYIVTTILEAPYMMLKKNHEQF
WGNDKYEGYCAELAAEIAKHVGFTYRLELVGDGKYGARDAETKMWNGMVGELVYGKADMA
VAPLTITLVREQVIDFTKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIWMCIVFAYIG
VSVVLFLVSRFSPYEWNGEESDDEDETAPSSSRRAQASSSAEHTHSPGFSQAQGQNQNQQ
KEKETPECTNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTAN
LAAFLTVERMVSPIESAEDLAKQTEIAYGTLDGGSTKEFFRRSKIAVFEKMWSYMRSADP
SVFVKSTSEGMIRVRKSKGKYAYLLESSMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKG
SPLRNPVNLAVLKLNEQGLLDKLKNRWWYDKGECGTGGGDSKDKTSALSLSNVAGVFYIL
IGGLGLAMLVALVEFCYKSRIESRRMKELIDAAMMSTSLGGIAVAGGGAVAGGLGVGPSG
LGGENGRVVAHDFPKAGAQGLPCMSKAAGLGLSSTGM
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaagagggaaggactccgagacacacacacacagaggagcgctaccggtgga
cgtgagtgtgctcgcgggctgcggagcgtctctccggtcagctgtgaatgggattacggc
ggctcctccgggactgcaggaggaaccatgcggccgcagagctgcccgctgccctcagca
ctgctcccgctgctgctcgggctctgcagcggcacaagtttcccaactaacatcaacata
ggaggccttttccccggtgactcccatgagtacgaggtgtttcgtttcgccctggcacaa
aaccaggacatccccaagctggtgccacaggtggacatggtggacacgagcagcagtttc
gccatgacctacgccttctgctcacagttctctaagggagtgtacgccatcatgggtctg
tacgaccggcggacggtcaacatgctgatgtccttctgcgggtctctgcacgtctgcttc
gtcacgccgtccttccccgtgcagaccaacaaccagttcgtcctgcagctgcggccccag
ctgcaggagcccctcatggccctgctcgagcacttctactggaccaggttcgtctacatg
tacagctctgaatcaggtttggcagtgttgcagaggatcctggacacggcggcagaacga
agttggcaggtcacctcggttaacctggacagtctcacagagccggccttcatcaagctg
ctggctgacctcgactacaagaaggacttccagatcatcatcgactgcgagctgaaacgc
ctcaactacatcctcaacctgattgctgctcagaagaggaacttgaagaactaccactac
atccttgccaatctgggcttcttggacctgaacgtcacagaatttcagaagctcggaccg
aacgtgaccggcttccaactggtgaatcggtcggatcccgctgtgcagaagatcaatcag
aactggctggacttcgacaacaaagacctcaaagtggctcgcaggaggctcaagtacaca
ggagctctgacctatgatggtgtcagcgtcatggcaacggcattccagaatctgcggagg
caacggatcgacatctctcgccggggcaacgcaggggagtgcctggccaacccgcccgct
ccgtggngacagggcatcgatatccagagagccctgcagcaggttcgtctggaggggctg
acgggtcacgtccagttcgatgagcgcggacatcgaaccaactacactttgactgtgatg
gagctcagccacattggacccaggaagatcggcttctggaatgagaagagaggctatgtg
aacactgccatctacaagccgatgcaggaggagttttacaatgtgcagaacaaaacctac
atcgtcactaccatcctggaagctccctacatgatgctaaagaagaaccacgagcagttt
tggggaaacgataaatatgaaggttactgtgccgagctcgccgcagagatcgccaaacac
gtcgggttcacgtaccgccttgagctagtaggtgacggcaagtacggtgccagagacgct
gaaacaaagatgtggaatggcatggtgggagagctggtgtatgggaaggcggacatggca
gtggccccgctgaccatcactctggtgcgagagcaggtgatcgacttcacaaaacccttc
atgtctctgggaatctccatcatgatcaagaaacctaccaagtccaaaccaggcgtcttc
tctttcctcgacccgctggcctacgagatctggatgtgcatcgtctttgcctacatcggg
gtcagcgtggtgctcttcctggtgagtcggttcagtccttacgaatggaacggtgaggag
tctgatgatgaagatgaaactgctccctcttcttctcgaagagctcaggcctcttcatcc
gcagaacatacccactctccagggttctcccaggctcaggggcagaaccagaaccagcag
aaggaaaaggagaccccagaatgcaccaatgactttggcatctttaattctctgtggttc
tcactcggagcgtttatgcagcagggctgtgacatctctcccaggtctctctcaggtcga
attgtcggaggagtttggtggtttttcaccctcatcatcatctcttcctacacagccaac
ctggcagccttcctcactgtagagaggatggtgtcccccatagagagtgcagaggacctg
gccaagcaaacagagattgcctatggtaccttggatggaggctccactaaagaattcttc
aggcggtcaaagattgcagtgttcgagaagatgtggtcgtacatgcggagtgcagaccca
tcggtcttcgtcaagagcactagtgaaggcatgatacgggtcagaaagtcaaaagggaaa
tatgcttacctgctggagtcctccatgaatgagtacatcgagcagaggaagccctgtgac
accatgaaagtaggaggcaacctggactctaaaggctatggagtggccacgcctaaagga
tcccccctcagaaaccctgttaacttggcagtgttaaaactgaacgagcagggcctgttg
gacaaattgaaaaacagatggtggtatgacaagggagagtgcggcaccgggggaggggac
tccaaggacaaaactagcgcgctcagtctgagcaatgtagctggagttttctacatcctg
attggtgggctgggcctggccatgctggtggctctggtcgagttctgctacaagtctcgg
attgagtcaagaaggatgaaggagcttattgatgccgccatgatgagcaccagccttggc
gggatagcggtggcaggaggaggagcggttgctggtgggttaggagttggaccgtcagga
cttggaggggagaatggccgcgtggtggcccacgatttcccaaaagccggagctcagggt
ttaccctgcatgagcaaagcagccggcctgggactctcctccacaggcatgtga

DBGET integrated database retrieval system