KEGG   Maylandia zebra (zebra mbuna): 101470815Help
Entry
101470815         CDS       T02814                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 14
  KO
K15261  poly [ADP-ribose] polymerase 10/14/15 [EC:2.4.2.30]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101470815
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101470815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro PARP
Motif
Other DBs
NCBI-GeneID: 101470815
NCBI-ProteinID: XP_024660318
Position
LG12
AA seq 1268 aa AA seqDB search
MMAALAHQIVEVEDQKVLKLPTWGHLKQKLLDTYNLSKKKTVAIEMHPERRNKITVAGFV
NPVKEVSHSLKEFIASHSQVLETLHVESCAVVSFIKRKKSKECSSIVKDNHVSVRFYVQK
QGISILGARLHVQKAKSCFRELASALFTDTLTVDKPGAKKYFQNQGSIFLSTIMNELRCA
VFLRPEIEEEEEAANYEEETKLCYCKVQTISGVLISVSKMDICIFGVDAVVNAANEDLDH
IGGLALALLKAAGPQLQRESSDYVAKNGRLRPGDAIITDAYNLPCKHVVHAVGPRFSDFD
KKTAVSRLKTAVTESLRQAEMANCSSIALPAISSGIFGFPVDLCAETIAQAVREHCDSPQ
GLRSLTEIHLVDNNDRTIRVLATAVSKEFSDLGPTMTIPQQAGGKRIAASGGHKRGPCRG
QNQSHDASWCNEKREEGRGGGRGGNHHGNRGGLSPKQQISHREHEGLEQTTAEGLKIILC
KGSIQDQTTDVIVNTISEDMKLNQGAVSKAILSAAGSSLQDAIYSEARRNTLRYGDVVVT
DGYNLTCQKVFHAVCPFWDKGGGQAEEELTSIIRYCLVEAEKRQMASLSFPAIGTGHLSF
PRALVSKLLLREIRSYSSSRNPRCLREVVIVVHPSDSQTVDCFTSQTAQRNVQHEARGFN
EVPAQQAVDQSQHSSVLSTTLDVYQMQIDQLTFEASSGDITKEASDVIVNSSNQSFNLKA
GVSKAILDGAGVTVEQECAQLVTPTAQPPAMILTSAGQLPSRNIVHVVGQNDPANIKNTI
YSVLKVCEKKKFSSVAFPALGTGQGGASPSEVAEAMVDAVVQFVKRKQPRFVQSVKILIF
QTAMLKHFHMSMKKRQEERVEEKSVVSKTEAEQPIAADLVLEREEFKPAVFQLCADDHKA
ASQAKKRIIEEIRTEQAQKTISDPCISQLSQADMEKLKALQRELTVSIRLDKGAEDQDPE
IHLEGLTRDVYTAESTIRDIIRKLERAEALMKKALVMSELVEWQFKDHNGLMVAFDLNTN
LTLEEAFKTRENAKIRINNEVYTADPEREKAVSANGRNDVELHRKDLKGTSALPLPSCWE
DMKDDLLKLFAVAPASNEYNDVEKELTKTGLNLNIISIERVQNPLLWQNYQIMKKQMEVK
NKHTNNERLLFHGTTDTSIHLINKQGFNRSYAGKNAAMYGNGSYFAADPCYSARNYATPD
TNGHKRMYQARVLVGDYAQGQQGMITPPPKSGSASDLYDSVTDDAANPTMFIVFNDIQAY
PEYLITFT
NT seq 3807 nt NT seq  +upstreamnt  +downstreamnt
atgatggctgctttggctcatcagattgtagaagtggaagaccaaaaagttctaaaactt
cccacctggggccacctgaagcaaaagctgctggatacctacaacctatccaagaaaaaa
acggttgccattgagatgcatccagaaagaagaaacaaaataacagtggctggttttgtt
aatccagtgaaagaggtcagccacagtctgaaggagtttattgcaagccattcacaagtc
ctagaaacccttcatgttgaatcctgtgctgttgtttcgttcattaaaaggaaaaaatca
aaggagtgttccagtattgttaaagataatcatgtatcagtaaggttttatgtacagaag
cagggcatcagcatccttggtgctcgtcttcatgtccagaaagccaaatcctgctttagg
gaactggccagtgctctcttcactgacaccttaactgtggacaagccaggagcaaagaaa
tatttccaaaaccaaggaagcattttcctgtctacaataatgaatgagttaagatgtgcg
gtcttccttcgtccagagattgaagaagaagaagaagctgcgaattatgaagaagaaact
aagctttgttattgtaaagtgcagaccatcagtggagttctgatttctgtcagtaagatg
gacatctgcatctttggtgtggacgctgtggtcaatgcagctaatgaggacttagaccac
attggtggcctggctttggcactgctaaaggctgcaggaccacagctgcagagagaaagc
agcgactacgtcgctaaaaatggacgtctacgtcctggtgacgccatcataacagatgcc
tacaacctgccttgcaaacatgttgtccatgcagttggtccacgattctctgactttgac
aagaagacggcagtgtcacgcctgaagactgcagttacagaaagtctgagacaagcagag
atggccaactgctccagcattgcactgccagcgatcagctcgggcatctttggtttccct
gttgacctctgtgctgagaccatagcccaggcagttcgggagcactgtgacagcccacaa
ggtctgagatcattaactgagattcacctggtggacaacaatgataggaccatcagagtc
ttagctacagctgtgagcaaggagttctcagacctcggacctaccatgaccatcccacag
caagcaggcgggaaacgaatagcggcttcaggtggacacaagcggggtccatgcagaggt
cagaatcaatcacatgatgccagctggtgtaatgaaaagcgagaagaaggaagaggtggt
ggaaggggaggaaatcatcacggtaacaggggaggcctgagccccaagcaacaaatcagc
catagagagcatgaagggttggagcagaccacagctgaggggctgaagatcattttatgt
aagggaagcattcaggaccagactactgatgtcatcgtcaacaccatctcagaggacatg
aaactgaaccagggagctgtgtccaaagccatcctgtcagcagccggaagcagtctgcag
gacgccatctactctgaagccagaaggaacacgctgcgatacggtgatgttgtcgtcact
gacggctacaacctcacgtgccagaaagtctttcacgctgtttgtcctttctgggacaaa
ggaggcggccaggcagaggaggagttaacgtccatcatcagatactgtctggtggaggct
gagaaacgtcagatggcatcattgtccttcccagccatcgggacaggacacctgagcttc
cccagagccctggtgtccaaactcctgctgagagagatccgctcgtacagcagcagcaga
aatcctcgctgtctgagagaggtggtcatcgtcgttcaccccagtgacagccaaaccgtg
gattgtttcaccagtcagaccgctcagaggaacgtccaacatgaagcacgtggttttaat
gaggtaccagctcaacaggctgtcgaccaatcacagcactcctcagtcttgtccaccacc
ctcgatgtgtaccagatgcagatcgatcaactcacctttgaggcatcatcaggtgacatt
accaaggaagccagtgatgtcattgtcaattcctccaatcagagctttaaccttaaagca
ggggtgtccaaggcgatcttagacggtgctggagtaacagttgagcaggagtgcgctcag
ctcgtgactcccacagctcagcctcctgcaatgatcctgacatcagccgggcagctgccc
agcaggaacatcgtccacgtcgtcggccagaacgaccctgcaaacattaaaaacacaatt
tactcggtgctgaaggtctgcgagaagaaaaagttcagctctgtcgccttcccagccctg
ggaacaggtcagggaggggccagcccttcagaggtggctgaggccatggtggatgcagtg
gtgcagtttgtgaagaggaaacagccgaggtttgttcagagtgtgaagatcctgatcttc
cagacggccatgctgaaacatttccacatgagcatgaagaagagacaggaagagagggtg
gaggagaagagtgtcgttagcaaaactgaagcagagcagccaatcgctgctgacttagtc
ctggagagggaggagtttaagcccgcagtgtttcagctgtgtgccgatgaccacaaggca
gcgagtcaggccaagaagaggattattgaggagattcggactgagcaggcacagaaaacc
atctctgacccctgcattagtcagctgtcacaggctgacatggaaaagctgaaggctctg
cagagagaactgacggtcagcatccgcctggacaaaggagcagaggaccaggacccggag
atccacctggagggtctgaccagagatgtctacactgctgagtctacaatcagggacatc
atccgtaagctggagcgggcggaggccttgatgaaaaaggccttggtgatgagtgaactg
gtggaatggcaatttaaggaccataatgggttaatggtggcctttgacttgaacaccaac
ctcaccctcgaggaagctttcaagacaagagaaaatgcaaagatcaggatcaacaatgaa
gtgtacaccgccgacccagagcgtgaaaaagcagtttcagcaaacggacgtaatgatgtg
gagctccatcgaaaagacttgaaaggtaccagcgctctgcctttgccttcttgttgggag
gacatgaaggacgacctgctgaagttgtttgctgtggctccagcatctaatgaatacaac
gatgtggagaaagaactgacgaagaccggactcaacctcaacatcatcagtatcgaacga
gtccaaaatccattactgtggcagaactaccagatcatgaagaaacaaatggaggtgaag
aataaacacacaaacaatgaacggctcctgtttcatggcaccactgacacctccatccat
ctgatcaacaaacaaggcttcaaccgcagctacgcaggaaaaaatgctgcgatgtacggc
aacggctcttactttgctgcggacccttgctattcagcaagaaactacgcaacgcccgac
accaatggacacaagcgcatgtaccaggccagagttctagttggagactacgcccaagga
caacaaggcatgatcacccctcctcccaaatctgggagtgcctcagacctgtatgacagc
gtcacagatgacgctgctaatccaacaatgtttattgtcttcaatgatatccaggcctac
ccagaatacctcatcacatttacataa

DBGET integrated database retrieval system