KEGG   Maylandia zebra (zebra mbuna): 101470893Help
Entry
101470893         CDS       T02814                                 

Gene name
suclg1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial isoform X1
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00020  Citrate cycle (TCA cycle)
mze00640  Propanoate metabolism
mze01100  Metabolic pathways
mze01200  Carbon metabolism
Module
mze_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mze_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101470893 (suclg1)
   00640 Propanoate metabolism
    101470893 (suclg1)
Enzymes [BR:mze01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     101470893 (suclg1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     101470893 (suclg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 Glyco_tran_WecB
Motif
Other DBs
NCBI-GeneID: 101470893
NCBI-ProteinID: XP_004549581
Position
LG6
AA seq 330 aa AA seqDB search
MILGHLGYRTVCSAKEALQHSGVRHCYTGTRKNLYIDKNTKVICQGFTGKQGTFHSQQSL
DYGSQLVGGVSPGKGGKTHLGLPVFNSVKEAKQGTGADASVIYVPPPFAAAAIIEAIDAE
IPLVVCITEGIPQQDMVKVKHKLLRQSATRLIGPNCPGVINPGECKIGIMPGHIHKKGRI
GIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTNFIDCLEVFLQDPKTEGIILIG
EIGGNAEENAAEYLKQHNSGDNSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIA
ALQSAGVVVSMSPAQLGSTMFKEFEKRKML
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgattttggggcatttgggctacaggacagtgtgttcggcaaaagaagccttgcagcac
agtggagtcagacactgctacacaggcacaagaaagaacctgtacatcgacaagaacacg
aaggtcatctgccaaggtttcacggggaagcaggggacgtttcacagtcagcagtctctc
gactatggctcccagttagttggaggagtttcccctggcaagggtggcaagacccacctt
ggcctgccagtttttaactctgtgaaggaggcaaagcagggcacaggggcagacgcctct
gtgatttatgtacctcctccattcgcggcagcagccatcattgaggccattgacgcagag
atacctctggtggtgtgcatcactgagggcatcccccagcaggacatggttaaagtcaaa
cataagcttctgcgccagagcgctactcgcctcataggcccaaactgcccaggagtcatt
aatcctggggaatgtaagattggcatcatgccaggccacattcacaagaaaggaagaatc
ggcattgtttctagatcgggtaccctgacatatgaagctgtgcatcaaactacgcaagta
ggcctgggccagtcactctgtgttggtattggcggggatccatttaatggcacaaacttc
atagactgtctggaggtgttcctgcaggatcccaagacggagggcattattcttattgga
gaaattggaggaaatgcagaggagaatgcagcagagtacctgaaacagcacaactctggt
gataattcaaagcctgtggtatccttcatcgctggtctaactgctcctcctggccgtaga
atgggccatgctggtgccatcatcgctggcggaaagggtggagccaaagagaagattgca
gccctccagtcagctggagttgtagtcagcatgtcccctgctcagttgggcagcactatg
ttcaaggagtttgagaagaggaagatgttgtaa

DBGET integrated database retrieval system