KEGG   Maylandia zebra (zebra mbuna): 101471748Help
Entry
101471748         CDS       T02814                                 

Definition
(RefSeq) titin isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101471748
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101471748
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mze04812]
    101471748
   04147 Exosome [BR:mze04147]
    101471748
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101471748
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   101471748
Membrane trafficking [BR:mze04131]
 Others
  Actin-binding proteins
   Others
    101471748
Cytoskeleton proteins [BR:mze04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     101471748
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101471748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Pkinase fn3_4 C1-set Ig_6 Pkinase_Tyr Ig_5 THB Ig_4
Motif
Other DBs
NCBI-GeneID: 101471748
NCBI-ProteinID: XP_023010042
Position
LG16
AA seq 28676 aa AA seqDB search
MSTQAPTFTQPLQSVVALEGSAATFEAQISGSPVPEVSWFRDGQVLSTTTLPGIQILFSD
GRAVLRIPAVMAAHSGRFSVRATNGAGQATSTAELLVTVETAPPNFLQRLQSLTVRQGSQ
VRLDVRVTGIPTPAVKFYREGAEIQSSADFRILQDGDLYTLLIAEAFPEDSGTYSVTATN
NSGRATSTAELLVQGEEAVPAKKLKTVSTSQISASQSRVQRVETSFQASTKREIHVGEGM
ITQHLAHKTPPRVPPKPTSKSPPSYVSKVTAGRQQSPSPVRHVKGPTPTPVRPVSPSTKL
SVSPIRPVKSPIMTRKQVSTSAEVLPPWKQGDYATEASYTSMASMTAVSSTTQLHMEKHW
EQQVAATREEVAAVPTRSQEPVVPPTLIAGLKNLTVTEGESVTLECKISSHPSPVIIWFR
EDYKIESSIDFQISYEHGFARLIIREAFAEDSGRFTCTATNEAGTVSTSCYLLVKVSEEI
ESREETAVTEIAITQEKTVAAETKLQTVTELSAGEPAAPFFIKKPTVQKLVEGGSVVFEC
QVGGNPRPHIIWKKNGVLLTTGYRYKVAYKETGECKLEISMTFADDAGEYSIFAKNPHGE
ASASTSLLEEEEYEAHMKQHDVTYKTEVTTSVVQEPSVVVSQYELEQRRTITPMSFVSET
EFLISAFEERIIQKIELCIMTITYRELVAEDGELVVTIADEEAVQPAFDTPVKNYRIMEG
VGVTFHCKMVGKPLPKIAWYKDGQRIRPSARYQIEVLQDGRASLRLPVVLPEDEGVYTAF
STNMKGNAVSSGKLYVEPSEAVTPQRYTPQPAVQRIRSTSPRSLSRSPGRSSSRSPRQSP
ARRFDETDEAQLERLYKPVFVMKPSSIKCSEGQTARFDLKVVGRPMPDTYWFHNGQQVIN
DNTHKIVIKEDGTQSLIIVPALPQDSGEWTVVAQNRAGRASLNVTLTVDAQETLARPQFV
EKLKNITVKQGTLVELAVKAIGNPLPDIVWLKNSDIITPHKHPQIKIDGTKGEAKFQIPS
ASGSDSAWYTATAINKAGRDTTRCRVNVEVDFAAPQTERKLIIPRGTYKAKEIAAPELEP
LHLRYGQEQWEEGDLYDKEKQQKPQFKKKLTSIRMKCFGPAHFECRLTPIGDPNMVVEWL
HDGKPLAAANRLHMVNEFGYCSLDYEVAYARDSGVITCRATNKCGVDQTSATLIVKDEKG
LVEETQLPEGRKGAYRMDEIERMAPEGGPAGVGADEESEKTKPDIVLLPEPARVLEGNIA
RFRCRVTGYPAPKVNWYLNGQLIRKSKRYRLRYDGIYYLEIVDIKSYDSGEVRVVADNPL
GTAEHTVKLEIQQREDFRTVLRRAPEPKLAEATHEPGKIGFDIVKMDRPSEASQDREVVK
LRKTQRILHEKTSEESEELKSKFKRRTEEGFYESISAVELKSRKRDDSYEDLLKKTKEEL
LHHMKEKEEAERKRMEEEGKLTIPTIKPERVLLSPSMEAPKILERIASKTVAPMDEVRFR
VRVVGRPEPECQWFKNGIQLEKSDRIYWYWPEDNVCELVIRDVETQDSASIMVKAINIAG
ESSSHAFLLVQAKTAVSFTQNLEDTSAKEKDTMVTFECETNEPFVRVKWFKNNTEIFSGD
KYRMHSDRKVHFLSVLMIEMRDDAEYTCVIADDENIRTSARLHVEGAALELIKQMENIEV
PESYAGEFEVELSREDAEGSWLFGDKVLSPSNKYIISSRRGRHTLSVKDVRKEDQGKYTF
VCGDLKTSASLKMKLRPVTLMQPLTDLIVCEGDIAQLEVRFSQENVEGTWMKNGQAISAS
ERIHIVIDKMVHKLLVENISTEDAALYSFVVPAQDISTSGKLSVQTIDIVVPLKDVSSIE
GTKAVLEAKISAQDISSVKWYHNDKLLTPSDRIQMVAKGAKQRLVFTRTFASDQGHYKLV
VGKVDTSCSLTVEEVHIVKHMEDKVCSESQNVTFNVEVSHPGIDSVWTFRNQQIKPGPKS
KIESKGKAHSLTVIDAMKDEEGQYMFHAGEKTSSAKLTVSGGAITRPLQDVTVAESQTAE
LECEVANANAEGKWLKEGQPIDFNENVVSEVNGAIRRLIINITRPQDVGEYTYQVANSKT
TANLRVEGVKIKKTLRNQTVTETQEAVFTLELTHPDVKGSQWIKNGVELQNSEKYEIVSS
GVVQTLKVKDCNIQDESVYSFKLGKLSANARLNVEKIKIVKKIKDVTSLLDGTASFEMSL
SHDNIPVRWMFKGLELKSSEKCKILSERKAHKLILKNLDSSDAGEYVAVVGHLQCSAVLT
VEALLVTKPMKSVEVPETQVATFECEVSHFNVPSTWLKNGVEIEMSDKFRIVVQGKLHQL
KIMNTSRDDSAEYTFICGNDQVSATLTVNPVLITSMLKDLNAQERDTITFEVTVNYEGIT
YKWLKNGVEMKSSDRCQVRSRQLTHSLTIRNVHFGDGGEYKFVAGSAATTANLFVEARVI
EFTKKIKDIKITEKKKAIFECEVSEPNIQVMWMKDGQEMDMSEERYIVTAEKYVHRLVIQ
TVRMSDAGEYSVVAGSSVSKARLTVEGRDIRISEPPEREITVLEKHRATFEFEVNEEDVE
GHWLKNGVEIQFSMEERFNYVTIRKLHRLTISETYRSDAGEYTFIAGKNRSTMQLRINIP
EPPQILRHMEPQSVEAGKPARFSVQVSGVPQPQVFWYKNSQALSAGFKCKFLHDGNEHTL
LLIEVFPEDAAVYTCEAKNEYGTATSTATLNVEVSEVVSPDSPATVAPPVIISPMASTSA
CEGAPACFQCKVRGDDVKISWFHKKKEIKQSEFFRISQFDDSCQLEISRVYPEDEGEYTC
MATNNGGTVSCSATLTLDVTHVREQAETKTELEVKVPPVFRQKITPLEINVGSHTKFECE
IEEAPDVAFKWYKSGTEIRQSEKYRIVSHHTSSSLELLNPVKADSGEYTCKASNQHGTDS
CTASLIVTEMYPPVFVSKPDPMTLYVGKQAVFQCSLTGSSPMEVVWHKDNITISSEGNYV
MKCEKNKYSLHIKSLELTDQGVYLCKASNSVGVATFSVELKVIDKPRFVTVIEPVSAAVN
DPLRLECHVNEDTGVAVTWTRDGKKVHQSMECKLSFEDKVAVLEIPKSKLKDSGKYVCTA
ANEAGSSSCEAVVTVQEPPAFVKKMESKLTWKQGIAARLQCTIKGSPELHIHWFWNEREL
NNGDKYKISFKSGVATVEIMNLLVTDSGRYTCEVSNNAGSESCSTLLAVKEPPCIRKDLQ
TVEAVKGAAAHLECEVTGTAPFEITWVKNKKPITSDQKYKLISQDSIARLEIQTFDTTDI
GDYQCVISNDVGKVTTKAMAKLKDPPTFSKRVESVTAVLGNTVKLQGMIKGSTPITVKWM
KDSKMLRDDDPNIKMVFENGVVSLSITTVAISHGGKYSCQAENEAGQQKCEAILTVQEPA
RIVEPAESISVTAGDSAALECTVSGSPDLKVKWFKDGKEIISGRKYKMTLKDNIATLKIL
TAEKGDTSEYKMEVANKVGKDQCTCSVTVLDRIMPPAFTKSLKRVDGNIDNPVSMDCKVS
GSQPMTVTWFKDDQEIVSGDKFQPEFKDSSAILRIMWLEKADSGVYKCRATNSAGFKETS
GTLYVKEPPAFTVKPHDQDVIPGTTVSLRTAFTGTAPLTVKWFREEKDIITGGTYFIKKD
ASSSSLELHSVKPTDTSKYTCEVSNDAGKVDCTVVLFVKEPPVFVRKPEATKLITSGDSA
RLECKVTGSPVIGFKWFKDEMEISASTKYTMSLIDLMATLEIANCTVEDTGDYVCVASSE
AGSDHCTCTVIVKEPPLFLRSLEHRDVVKGSELMLECQVSGSAPFTVSFHKNSKLIRNDK
RHRITVKDDLLALQVLVVETGDVGLYQCSVENEVGRASCDCHVTLKEPPSFVRKLENLSS
LAGSEVSLICSLKGSEPITVAWLKDNHELKEAENIQITYENKTALLQITNLQSSHCGKYS
CQVQNQAGSQTCSAVLTVKEPAKITEEVKSISVTQGDPATLEARFSGTKPLKVRWLKAGK
ELTSGQRYKVQSKDTSSVLKIIKTQKSDGGEYVFEVSNDVGQSSCDATLTILDQIIPPSF
TRKLKQTEGVKGSFAHLECLVSGSLPITIQWYKDEKEIQTDDKHKCTFFENVPFLEISNL
DTKDSGNYTCIATNKAGTVQCSGVLFVKESPCILEKPESINVLPGSKVQFSVLFSGTPPL
TTKWFKSSKEILSSADWSVIKDNTSSTLELFFAKTTDSGDYVCQIQNDVGSASCQATLFV
KVPPKFTQIPARVSVVCPGQSKVFECQVTGTPEIDIYWFKEGSEISPTDHYKMAFVNSVA
TLEVCGAEVKHSGLYYCEARNEAGSESCSMELKVKEPPSFIRELARADVVKGSTAMLECQ
VAGTGPFEITWHKDGKELKPSAKHAFSQLNDTVCLEVHKCDAVDIGEYQCTVANEVESCT
CKTTLSLKEPPTFIKTIENTATVLGKMAEFQCIVKGSPITSVQWKKDENWILEDPKIQRT
FESNVATLRIPACEAIHSGKYTCQVVNEAGQDKCFAALTVQVPPQITEKPEVVKVTVGDP
VSLDCKVTGSPELRVKWMKDGRELKSIRQHKLIFENNISSLKIQAAQTEDEGEYVFEVVN
YISSCTCKVKLIVLEQVIAPSFIKPLVDMHEILGSFVQICCKISGSLPISVEWKKDGTKI
SSGLKHKLIQQDNSVSIEIEQLERADAGLYSCKLTNAAGSCECSGSIVVKEPPSFVTVPE
SQTALPKATARFKGTFKGTPPFTVKWFKDDTELMTGPTCLIGLDGLSCFLELYSVGVTQS
GVYSCQVSNDAGSVHCSANLTVKEPPEFLLKLPANKFLKQGESLRLECKVSGTVPLKITW
FKNDTKVTDGGNYRTSFVDSVAVLELVSTSFEDDGVYTCEAQNDAGSVSCSTTLTIKDPP
SFVKIPQPVEGLKGKDVSLYCEISGTAPFQITWFKDRKPLMESRKFKLVSEGSSATLHVI
GIEPSDAGEYECKVSNSVGSDTCQTSIKLREPPSFVKRLSNITVILGGEVTLVATVKGSE
PITVSWVQDKDHILRDSDNRKITYENNQVAVKIFNADATTAGKYTCQLRNDAGSVECFAN
LTVLEPAKIVDKPDALSVTAGDMAALEVKVCGTPELIPKWFKDGAELASGRKYKISFSRM
ISSLNVLSAEKVDSGEYTFEIMNEVGKDLSKINLTVLDKTIPPTFSRKLKDCTTVVGKPL
EIECKVSGSSPFTISWYHNDEEIKSGPNYEISFSDNNCTLRVLTLKLADSGAYKCKAVNK
AGTTETTAFLVVREPPTFVVPPQPVEAMPGSNVMFSAMVKGSAPLKLKWFRGTKEIVAGH
GYDFSLDDNKVLLELYNVDKSHAGEYTCQIINDAGKESYPVNLTVKEPATFSKKLKDISV
EKGKPLTLECTYTGTPMITVSWYKDGQQIFASYKYNITTTESSCILECLSTDDKEAAGKY
CCQVCNDAGKDTCEAVVSILEPPYFTESLEPMEVTAGDAVCLKCQVAGTPEIKVSWFKAD
GKVRSSPTCKLEYTKGVACLKLSKATKSDIGEYTCKAENRIGSASSSCRLNVQEAKTPPS
FPKKITSLQQTEGQPVRFECRVAGSLPIEVSWLKDGKPLSQGEEFSMLYDDNTAVLQINN
SEMRHSGEYTCVATNSVGSASCRAKLTLQEPRYPPVFDRKLSLQEVTVGDSIELECHMTG
STPIKVTWSKDHKDIRSGGNYKISCVDNTPHLTILKADKSDTGRYFCHASNDMGKDSCSS
DITVKERKNPPVFTKKPSEHIEDMEGKLVKIEGRVSGSQPISVSWFKDDMEIQSSDKYDI
SFKSNVAVLCIKNSQVIDSGRYSCQASNEAGKASCDVTVGISEAKKPPVFDVPLKPATVD
DGEKLILRCHVCGSSPLKIQWMKDRKELTPSSSTRISFSDGTACLEISTVSKLNAGDYLC
KATNEAGSEFCKAKVTVKEKPGAALSPAEAPAASPSKKLDNLFFIEEPKTAHVTEKGTAT
FIAKVGGDPIPSVKWMKGKWRQVTHGGRISIEQKGQEAKLEIKEVTKSDSGQYRCVASNK
HGEIECSTDMHVEEKKDVVMLEGDLRAKLKKTPSKQKSPQEEKDIDIVELLRNVDPKEYE
KYARMYGITDYRGLLHAIEQLKKERAEESGRQEVDRGDRESDEDMARLVADLQKRMERTE
PVTVVKDISNQSVFINEEAVFECEIKINYLEITLSWYKGTQKLDTSDKYNITISGDRHLL
RIKNCQSSDQGNYRVVCGPHISSAKLSVMEVEVEKHLQDTMGKEGQSCTMSCQMSIPNVE
AQWFKNGKQLEMKDRYTSEVKHKVQKLLIRDLKPEDQGRYTCKYQQLESSADLWVEAEQI
HFTKRIHNIEVNERQSATFECEVSFDNAIVSWYKDTWELKESPKYNFRSEGRRHFMVIQN
VTVEDEGVYSVIVRLEPRGEAKSTAELYLSGKEIELAMVPIDMPDSSVQRPEVPTSVAIQ
ESYEFYHYEEEIEAVVRVAIEETMETKQVQMREEIPTKVEERPEEKPTPASPQREPEARK
QVEEKIAVVSVPEKDVPVPRETEEVKRPTASPPPPTEKPGVPKKDEPKPQVPADSKVVAP
EAKPEAEPKPKPKAEPEAKPVPTPKAEPEAKPVPTPKAEPKVKPEQIPEQEPEAKPVPVK
KMVTPPSKVPEEAAKPDPSKTRRKPAETRLEPDKPKPEAHKPEPSLTKPEPKEPAVVPKP
EPVVKKSAEITAPKPVVPKPEPPVTKPEPTPAPKEPAKKASEEPAKKEVSAPIQPPQPSL
AQPEKFETEEQAPQKKPVAVKVPVEEKITELPKAAKKAEPAVVPPKEEPTRKEKALKLEP
KPVPEKSYQKVFDEVAVLEPEPVKLPEKISESVPERRLEKVLKPEKAMKEIPKLEPEKLP
EKVPEKPREEKVPEEALPKRKPVKVPQKVVEEALITEKQTSVSTEEIKVELISKKQTEKI
SVEKTVHVKAPDAIPDIVSKAKPKQEVEEILPKETEAKKTERILHTEIEEDIKIYATKKV
LVKEKELVPEIKESLVKPAAPQKVSKPQAAVKDQEAAKKPEVTDNAKLKKTITPPEEKPV
VVTKPVMAAEEPTKMIAEEEKPLTKKISPGTDESKGPVQAPGGVKKEGQPTEEAGRGRGR
GLKPKQTPSPGEGRGRGLRPGGKGPPPPEEPFAGFKLKAVPLKFIKKLQNIVLQEAESIG
SSAVFECEVSPSTAVTSWMKDDSNLRESPKHKFTSDGKDRKLNIIDVQLSDTGEYTCVAK
NAGKEISCTAKLIVEELPVKWIKELGEETSAIKGQPLYMTCELNKERDVIWKKNGEVLKK
KEGKIQINIIGMQHAVTIQNSTEEDAGVFSCEVAGQEDVKTTTNVKVIEIVKDWIVKPLR
DQHVKPKAAATFKCELFKETPNWKWLKGENEVQPSDKIEIKKEGKELTLVIKNCQPDDVA
EYALEVEGRIYTAKLTLGEREAEILKPLVSVEVVEKEDAMFETEISEDDIPGEWKLKGEV
LTRSPTCDIQMEGTVRRLKLKNCQLDQAGEVTYTALNAITSAMLNVKERDIKVVRPLYSV
EVTETETAKFETEISEEDLHATWKLKGETLHPSANVEIKEEGTRHLLILYNCKMDMAGSV
DFAAANAKSSAQLRVKARVIGLQRPLKDVTVTAGETATFECELSYEGIAVEWFLGGTKLE
PSDRVVLKAEGKVHTLTLRNVEQNEAGQIKLAAKDFQTEASLTVKEPPVEFTKPLEDQTV
EEEATATLECEVSRENAEVRWFRDGQEIRKTKKYEMIVDGCKRALVIHDCTLDDSKTYAC
DAKDFKTSCFLNVEPPHIEFSKPLHDVEVVEKESARFECEVSREDVKVRWFKDGNEIRKG
KKYEIIAQGRQHILIIHKSVFDDEAEYECDAKTSKSSGMLTVVEEETRFTKNLFNVEGTE
TDSVKLICEVSKPSADVIWYKGDTELPEGGRYEQIVDGKRRILLIKDLNMSDAGEYNCRL
SSSNKTSGNLKINELAAEFISRPQSLEVVEGEKAAFTCSVSKETYEVKWMKDDVELEAGE
KYQIVTDGKKRILEIKDCELKDEGGYIVMIGPTRASADLTVLERLKIITPLKDTEGKEGQ
EVVLNCEVNTEGAKAKWLKNDDTIFESSKYVITQRDNVFSLRIKDVQKGDESNYSINLTN
QRGEHAKSNCSLTIREESLRIVVPPEDIDTQEKKTISFSCKVNRPNATLKWMKAGEEITL
SKRIVYRVDKDKHTLTIKDCTLADEGEYTAVAGDDKATAELIISEAPTDFNVHLKDQTIT
EFEDAEFTCKLTKEKAEVKWYRNGREIREGPRYIFERDGKICTLRIKECRPDDECEYACG
VEEKKSRARLFVEETPVEIIRPPQNVFEPPGSDVVFEVELNKDRVEVKWLRNNMTVVQGD
KYQMMSEGKVHRLQVCEIRPRDQGEYRVIAKDKDAKARLELAAVPQIKTTDQNYVTDVGK
PVIMVVPYSAYPQAEADWLYNNLSLQKDNIYTSAEHTEYRLKNPKKVDEGSYKIIIKNKH
GAGEAFINLNVIDVPGPVKNLQVTDTADGEISLAWEEPESDGGSKVIGYIVERRDEKRKT
WTLATDHAESPEYTVTGLQKESKYLFRVCARNRVGSGPTVETDEAVQAKNKFDVPEAPLN
VIVGNVTKFGCTLSWEPPTSDGGSPITSYIIELRDRTSVKWSPVLVAKPDDLSAIINDVI
ENKEYIFRVKAENRAGVGKPSAASQPVKIMDPIERPSPPLNLSWEDQNKSSVQLTWETPL
KNGGSMITGYIIERCEDGSDKWLRCNARLCPDLFYKVSGLKYGTKYNYRVFAENAAGVSE
PSNIIGPLLADDPHVGPSFDLSAFKDGLEVIVPQPLTIRVPITGYPIPVAKWTFGEKELS
SVHDERVFLMTKSTFTELMVTPSVRPDKGIYTLHLENDVTSVSGEIEVNVIAAPSAPKDF
KVLEVTRQHVHLSWEAPEHDGGSPLIGYQVEKRDVSRKTWVKVTTGIQDLEFTVTDVVEG
KEYLFRVTACNKCGPGEPAYIDEPVNVSSPATVPDPPENLRWRDKSASGIFLTWEPPKYD
GGSGIRGYNVERCQRGTDKWEPCGDLVPELKCQVTNLIEGQWYSYRIRALNRLGASRPCK
ATDEIQAVDPKEPPEIQLDAKLLAGLTAKAGSKIELPADVTGKPEPRVKWTKADLVLKPD
DRVSIDTKPGHSMVTIAKTKRDDSSTYIIEATNSSGRATATVDVNILDKPGPPAAFDISE
ITNESCFLAWNPPRDDGGSKVTNYIVERRAADSEIWHRLSSTVKLTTYKATSLIKFKDYI
FRVFAENQFGVGPAAEHPSITAKYPFDTPGAPYKLEASDIAKDSLNLNWYEPDEDGGSPI
TGYWVERYEADHDKWIRCNKLPVKDTNYRVKGLPTRKKYKFRVLAENLAGTGKPSKETDP
ILVKDPIDPPWPPGKPTVKDVAKTSCFLMWTKPEHDGGAKIDSYVIEMLKTGTTDWIRVA
ENIPMLEYFLKGLMEKQEYSFRVRAVNVAGESEPSEPSDPVLCKERLNPPSAPRWLEVVN
ISRNSAELKWAVPERNGGSAITNYIVEKRDVRRKGWQTVDTTVKELKCDVKPLNEGSLYV
FRVAAENAVGVGPFCEMEDSVLAKDTFSTPGPPYALAVSAVTKRYVDLQWEAPKNDGGRP
ILRYSIEKKEKLGTRWVKCGKTSGPDCKYRVTDVIEGTEVQFQVRAENEAGSGHPSEPTE
ILTIEDPTGIPSPPIELHVTGASRDFLAIAWKPPQTDGGAPVRGYHIEMCEAGTEKWMRV
NSRPVKELKYRVEEGVTPEKEYILRVRAVNAIGESEPSDISENVFAKDSDCNPTLEFQTL
DLVVVETEKLHIPVPFRAVPLPKITWHKDGKELKADERLGFRKEYTSCHLEIDISLHADA
GVYKVTLENKLGSASATINVKVIGLPGPCKEIVASEITKSSCKVSWDPPDYDGGSPILHY
VLQRREAGRRTYVNIMSGECKVSWVVKDLIHNGEYYFRVQAVNKIGGGEFIELRNPVIAE
DQKHAPDPPVDVETHNPTSSTVTLTWKPPMYDGGSKIMGYILEKQQKGEDKWERCNDFLV
PVLSYTVRGLIEGKNFTFRVRAENAAGISEPSRNTPFIKAADTIDPPKVFLSGSLQSGLA
VKRGYEICLDANISGSPYPQITWYWNNQSIQPEPLRKRPEKPLKKKVEKKEEEKKEEKEK
EEGTAEKKEEKEGEVKEPEEKEGEVKKEGEVKKEEEVPQPEVEEPDYPTINERLAIDNSH
KGVSSIVIRDSIRPDHGVYMVKVENDHGIASATCEVNILDTPGPPVNFRFEEVRKNSVIC
KWDPPLDDGGSEILNYTLEQKDNSKLEIGWSTVTAILKGCRYLVPKLIEKKEYIFRVVAE
NKYGAGPPCVSKPVIAKNPFEPPEAPDKPQVDDITANSMLVTWNEPNDNGSPILGYWVER
REINSSHWARVNRNIIPVPELNVEGLIEGLTYIFRVAAENQAGPGKFSVPSEPKTAQPAI
LPPGPPVARVAATTDHSIEVEWDPPADNGGGEILGYHVDKAMAGTKDWSRSTERPWKTRN
FTVYGVREGAKYTVRVIACNAAGEGTPGFTESVFVRNPAEIPVIELDLSVKNGVVIRAGE
NLLIPATVTGKPYPAITWTKDDGKPDKDRAEILTEDNNSIFSVKNVQRKDCGKYQISACN
PSGIKSAWTRVEVMDVPGPVTDLKPVVVTRKMIFLNWDDPEDDGGSDLTGFLVERRDPKM
HTWRQPVETASSKCECVGIMEGQEYLFRVIAKNKYGLGPPVELGPIKAVDPQGPPSYPEK
FHYTERTKNSITFAWKPPRNDGGSPIIGYFVEKKRQDQQAFEPCNTEICPNMTMTVEGLD
DAWMYEFRIKCANLIGESEPSIPLTVVIQDDEVSPEIHMLKQFKGDTITVKKGESIEIPA
DVLGLPIPKIEWSKDDVVIEKPTETLLMETNVTGRMNCKTMLSIPAANRRDRGSYTVAAS
NNMGSATHTVYVMVLDRPTPPRNVTVTNIRGESCYLNWHAPLDNGGSELTNYIIEKKEVV
TEVPEVEEGQEAPPEPQWEEVTNSIIERKYEVWNLEDKKTYLFRVRAENRYGKSDPCTTE
EVQIIDPFGLPGPPEKPTIAEYCKTSMTLTWEPPRDNGGSTIIGYWLEKREKGTAYWAKV
NKMPITKRGMKGWEYQVTRLFEGTEYEFRVAACNSAGTGPFSGPSDSAFAVDPLTPPSMP
AAPEVADKTKHNVTLSWKPPESDGGSPIKGYIIQIQDEGTSEWVRVNDPETLHPTTEFTV
PSLRELKRYRFRIIAVNDIGESDPSPRTSEVLIEDVQLPPSITLDVMADDLVSIRAGDPI
RIPTTIKGRPTPKVTWDFDGKAKSHKKNKLHTLPVDSEVESTDTTSVVTIPVSLRTHSGR
YTITAKNKSGQKHLNIRVIVLDVPGPPKDLKITDITRSTMRLIWKLPNTDGGERIKSYFI
EKKSVTDKAWTKVNVACASQAYVVPGLLEGQDYLFRVRAENRLGFGPFTVTTEPVRARDP
IYPPDPPTKLKVNLVTKNTVTLSWEAPKNNGGSPVKHYIIERLSWDTTGKEKETWKQCNK
RDVEELTFVVEDLKEGGEYEFRVKAVNAAGPSRPSATIGPMVIKDQTCPPTIELREAMEG
EEGCDISIVAKVSGCPFPSLVWHKASLDKPEEKSAIQYDQHINKLVTQDKCTLLIQQASR
HDSSLYSLTATNSLGTVCKGIKLSVFGPPGPPVGPVKFTEVFAERIGLAWNPPIDDGGSK
ITNYVVEKREENRKSWVHVSNDPKECTYVVTRLTENHEYEFRVMAQNKFGVGPPLVSDPE
KARNLFTVPGQCEKPTVTEVCLESMTVNWEEPKYDGGSPVTGYIIEKKETTAKRWIRVNR
EPIRALPLGNNWDVTGLLEGALYQFRVIAVNAAGCGLPSIPSDPILCRDPIKPPGPPTPK
VTDWTKSTVELEWIPPLVDGGSKVTGYIVEFKEVNKEEEEKKAQRRLLLSVAEEEKETET
EEAWEKAKDTEIRGTKFVVAGLKEGGLYRFRVRAVNAAGVGDPGLVSELIEVKDRTIPPE
MDLDASVKEKIVVHAGGTIRIIAYVSGKPAPQITWCRDDSEVPKEAVVETTGISNSLVIK
NCRRQHQGIYTLSAKNEGGERKKAVIVEVLDVPGPVGLPFAGENLTNDSCKLTWYSPEDD
GGSAITNYIIEKRESDRMGWTSVSYTVTRNNAVVQGLIDGKGYFFRIAAENIIGMGPFVE
TDKMVLIKDPISVPERPEDLIITAITKDSISVTWRPPKYDGGADVTSYVLESRMIGHDSF
VRVGGEDKLMDRRFTLTGLKEGSSHEFRVSAVNQVGQGKPSFATKPVQCKDELEPPTLDL
DFREKLMVKVGDTCMLSGRYSGKPAPAITWAKNDEDLKADEEISLHSTTHHLSLNISKAK
REHSGRYCVSVENAAGTRSGICTITVVDRPQPPEGPVEFNEVYRNYMVITWKPPLDDGGC
AVSNYIIEKRDTNRDLWMPVTSSCTRTTCRVPKLIEGREYIIRIMAQNIYGISDPLLSTE
TKARDIFKTPDAPKQPLVKEVYHDSALISWEPPADGGKPITGYIVERKETMANRWVRCNT
ERIHPKVEYWVTDLLKGCEYEFRVSAENEVGAGDPSPPSKPVFAKDPIVKPSPPVNLKAI
DFTKESVTLSWEPPTDTGRGKIFGYLLEFQAAGKEEWLKVNQTPDSCKETKFKVINLEDG
VLYRFRVMAVNAAGESNPANLTEPIRVQDRLEPPELILDAGMTREIKAMAGTHIALIAGI
KGVPFPTVTWKKNDAEVPPRADIETNQTGTKLEMRFCHRGDCGDYTLTVENPAGTKTVTC
TVLVLDKPGPVQHLRVSDVRSDSAYLSWKDPEDNGGTRITNFVVEKKDTASTQWVPVCST
SKKRSMMLKHLMEGTSYSFRVATENQFGRSEYVETPKAIKAMNPLFPPGPPKDLHHVDVD
KTEVWLAWNWPDRNGGSEIIGFLVEYQEEGEKEWYEWKTVSIPESHVTGLEEGKTYRFRV
RAENAIGLSRPDTTVPILCQEKLVPPIVEVDVKLTEGIIVKAGTTIRLPAIMRGIPVPTA
KWSIEGEEITSQGNIKIDTDNFSTILSINECTRNHTGTYLLTVSNPAGTKTVALNVTVLD
VPAAPIGPVNILEVMPDSMTIEWRPPKDDGGSPITNYIVEKRESNKETWGGVSSGSLATQ
LRIARLQKGVEYVVRIRAENKMGIGAPLESKPTVAEHSFMPPSAPGKPQSYDTSEDAVTL
GWTMPLTDGGSQITGYIIERRHKGGKWIRVNKTPCKDLRYRVLGLYEGSEYEFRVFAENI
AGFSGPSPVSDPCKPCRPITVPSPPVNPKVKDYSRATADLVWTKPTKDGGSPILGYTVEM
KKASAEEWKKVNLDDLIKQCAYRVKGLEEGVTYRFRVFASNMIGDGEPREIPESVTAQDI
LIPPEIEMEATCRDCVTVRVGHNINIIGYIKARPDPEVFWSKEETILENSKRVTILQNLP
LVHLKIKEATRNDHGKYILKASNEGGEASRTITVNVLDRPSHCQNLNVTYVTKGSCMINW
ESPKDNGGSEITNYIVECREPSISMWSMISSHCTNRKIKAKLMEGHEYLFRVCAENKIGP
GPSVEIKTPTLAMDPIDKPGEPENFRAIDIGKNYVNLRWRKPDYDGGSPHLSYNLECKTK
DAEEWEKLNTTTLTDTFFLADKCVENQTYTFRVQTVSEGGESAWVKLADILVREEIQKPV
IDLKLAGTLTVKAGESVRMEAALRGKPQPEVKWMKDKATGDNPRISYETGPDYSKFLMTK
SKRSDTGKYIITATNSGGTFTAYANVNVLDVPGPVRDLRITGIGADKCRVVWDAPEDDGG
CEVDSYILEKCETRRMVWSTYSASVVTPYCNVTRLVEGNEYIFRVRAENKMGTGPAMDSK
PITVKTQFNKPGPPDAPEVTKVSKDEMTVVWAPPENDGGKSITGYILERKEKRAVRWVPC
TKSPISERRMKVTNLIPNHEYQFRVRAENDVGLGDPSKPCRPVAAKDPIEPPGPPAALKV
ADSTKTSITLSWSKPVYDGGAPIIGYSLDMRLKSEADPENPTVGWKRIDTHGPLVLTEFT
IGQLDEKQEYEFKVSAQNQVGWGRHAYLKEAVSPKEILEAPEIELDASLRKGLSVRAGCP
IRLFAVIRGRPAPKVTWKRLGVDNVIRRGHVDQVDTMSFLVIPESTREDSGKYSLTLSNS
AGEKAIFVRVKVLDTPGPVGSLDATDITKTTAQLSWLPPENDGGSPILNYVVEKREVDRK
TWTKCTEDLKKTSFKVTNLTPGIEYYFRVMACNKYGIGVPQDSPRSYLAVDPISEPDPPK
KMDVLEITKNSATLGWLKPLRDGGAKINGYVVDYQEEGAPEDKWTPYSVVKDLTIVVVGL
KEGKKYKFRVAARNSVGVSLAREAEGMFEVKEQLMAPKIIMPDIVTVRAGSKMTIEAIVA
GKPAPVCKWKQGNEDVLTSDRLSIVKTLTTTSLIIKNVTRKDSGYYSLSAENSTAKINQI
LKVIVMDIPGPPEAPLEITELDMDACTLLWNSPQEDGGSNITNYIVEKCDVSQGDWITVS
TSCTKTSFRMTKLTPGKEYSFRVRAENRFGVSGPTYSEKMIARYPFDPPSEPRNLQINKI
NKDFVILSWERPSSDGGSPISGYCIEKKERNSLLWVKANETLVKATQYTCTGLIDGLEYT
FRVSAQNQAGQGKPCKQTDFITARTAVDPPGKPEPMDVTKSTVSLVWGRPKHDGGSKLIG
YYVEYTKLPEEKWTRCNANCMNIQTENYVVTNLQEGQQYQFRVIAKTAINSSLPSELSDP
IPVIAENVAPRVELGVNMKNLIVVKAGENVFLDAEVFGKPLPKVSWKKDGVPLVLAEGMK
MSQKKHLHLLELYSVTRKETGDYTITAENVNGTKYATIKVKVLDKPGPPASVKISKVFAD
RVKLRWVPPLADGGSEITNYIIEKRETSRANWALVTSNIHGHITDCSVEKLIEGHEYQFR
VSAENQYGVGDPIMTDAVTVKNPYDVPGPCEPPVITNITQNSMTVSWKAPANDGKSPILG
YMVEKREATELSWAKVNRRPVIDRTIKAIQLTEGSEYEFRVIAINKAGLGKPSDASNGAL
AVDPVYPPGPPAFPKVVDSTKTSVSLSWTKPAYDGGCEIIGYLVECKRVDAESWTRCNVP
KKLQATKFLLTGLMDNTEYQFRVTAVNKIGYSEPSEVPGNYMPKDILIAPDAELDADLRK
ALVLRAGVTMRLYVPLRGRPAPKVTWTKVDANLKERQGLLIKTSDWDTLLMIEDVNRCDS
GKYVLSLENSSGSKSYTIVVKVLDSPGPPLNLTVKETSRTHACITWDAPLIDGGSPVKNY
IVEKRLAERKAWTCVSADCPKISFRITNLEAGQAYCFRVLAENAYGIGEGCETPGSIRAS
EQPGPVTDFKAQKTTKNSITLSWKKPINDGGSFITAYILEQGEGEEKWKQILKGKNTSHT
IGELTEGKEYSFRVKALNESGEGPPTELTAIAKDQFVLPDCNLSDLHDGCCVVKEGSTTR
INIPITGVPNPTATWKKGDMGVGDTGRMCVEASQGITTLLIRDSQRGDADTYTINVRNSA
GSKDCKFQLKVVGKPGICTGPITFDEITADAITLEWGPPKDDGGAEVSNYIVEKRRTTDN
KWTTVASAIQKTTMRVIRLHDGIEYIFRVFAENKYGVGEHLRSDPVVAQHPFNVPGAPAP
PEIVSIRHESAILTWVDPKDTGGAPVTGYHIEYKEKNSLMWKRASKTPLRVKECRVTGLT
EGLEYEFRVMAMNMAGLGKASKVTEAVVALDPIDPPGKPEVISVTRSTVTLMWTAPKYDG
GYKLTGYIIEKLEASGKAWMKANHVNIQGCAFTVTDLTEGSQYEFRVRAKNAAGAISIPS
EPTPLLTCKDEYEPPTITIDPEMKDGIAIRAGDTIVISASKIVGKPPPTAAWSKGGRELK
TSDIVTITSTPTSSTLAIKYASRKNTGEYTITASNPFGIKEEHVKVKVLDVPGPPGPVEA
SNISAEKCTLTWLPPEEDGGSTIKSYILEKRETSRLQWTKLAENVMDCRHVVSKLIKGNE
YIFRVSAVNQYGTGDSTQSAPVKMVDSFSPPGPPSTPEIDNVSRNAVTISWKRPVRDGGS
DIRGYCVERKERRGLRWVRACKRTIPDLRFKVQGLSEGVEYEFRVTAENKAGFGEPSEPS
RPVMTKDIVYPPGPPSNPRITETTKTSATFTWGRPHYDGGLEVEGYIVEYKKEGHDDWET
ETQYPLKASEYVIGKLQKGGKYHFRVSAVNSEGIGEPAEVEKVTELVDQEMLPDFELDAE
LRRTLVVRVRASIRMFVPIKGRPVPEVTWSKDDANLKTRAHIDNTESYTLLVIPDCTRYD
AGKYHLSLENVAGKKTGFVNVKVLDTPGPPVNLKPREITKNSITLQWEIPIIDGGSKIRN
YIIEKRAATKKAYTVLSTTWQKCSFKIPDLEEGAYYYFRVSAENDLGVGEPAETPEPIRV
SQAPSAPENLYVTDVTSDSASLAWTKPLHDGGSLITGYVIEAQKKDTDQWVHVATIKALD
YTVTDLIEGAEYTFRIMAVNASGRSDPRESRPAVIKEQTSAPSFDLRGVYQKTIIAKAGD
RLKVEIPVLGKPRPVVSWKKGDTVLKETQRLNIETTPTSTILNINEIKKKDGGQYSMTGK
NMLGAMTETITILVHDIPGPPTGPIKLEEISCDYVLMSWDPPENDGGVPINNYIVEMRET
TGTSWVELAATVIRTTFKAARLTTGTQYQFRIKAQNRYGIGPSIISEPVVAVYPFDVPSQ
PGTPVVTSFNKDAMTLSWNEPSSDGGSAILGYHVERKEKNSILWQRISKALVVGNLFKST
GLIDGIAYEHRVIAENMAGLSKASKPSEPMYALDPVDPPGRPVALNITRHEVTLSWTKPE
GDGGFSITGYTVERREMPNGRWLKANFNNILETIYTVSGLTEDATYEFRVFARNSAGAVS
APSQSSEAILCRDDIEEPRLDVDASYSSTVVVMAGEVFKLEASVTGRPIPSLVWTKEGKE
LEDTAKIEIKTSEFHTTLTNKDSLRRDGGAFTLIASNPGGFAKFIYNVKVLDRPGPPNSL
TVTDVTAEKCVLNWLHPTHDGGAKIEYFIIQRRETSRLAWTNVATDLQANRFKVTKLLKG
NEYIFRVMAVNKYGVGEPVESEPVICANPYVPSDPPQQPEVTIITKDSMVVCWDRPEHDG
GSRINTYIIERRDKTGLRWVKCNKRTVTDLRFKVSGLTPGHEYEFRVLAENNAGLSQPSP
SSPFYKAIDTIFQPGPPGNPRVLDTTKSSITLAWNKPVYDGGSEITGYIVETCLPEEDEW
TIHTPKNGWTATSFTITNLRENQEYKINISATNCEGVGEPAAVPGTPKSEDRLVPPEIEL
GAELRKVVCIRACSTLRLFVPIKGRPAPEIKWSREHGESLDKANIEITSSFTTLQVENVD
RFDGGKYIVTVENASGSKTAFVNVRVLDSPGAPQNLIVREVTRDSVSLAWDAPVIDGGSR
VRNYIVEKRESTRKAYSTVCASCHKSSWKVGDLEEGKMYFFRILAENEYGIGLPVETLEP
IKASERPLPPGKVSLREVTSKSVTLSWEKPDHDGGSRITGYIVEMQGKGSEKWTQVMVVK
SNEAHVTGLTQGEEYTFRISSINEKGVSDPRPLNVPVVAKDLVISPTFKVLFSTFSVLAG
DDLKIDVPYAAHPKATATWLKDGVALKETTRVNADATDKNLLLVIKEACRDDVGTYTVKL
TNTAGEASTDISVIVLDKPGPPTGPIKLDEVTADSVILSWDPPQYDGGCAINNYIVEKRD
TSTTNWQIVSATVARTTIKAARLKTGSEYQFRIAAENRYGKSSALLSDTIVAQYPFEVPS
SPRSVTVQSTTKESMVVVWEKPSNDGGSKILGYHLELKERNNILWVKQNKQLVPETRFKV
IGLEEGIEYEFRVYAENIVGLSKASKVSEIQVARDPCDRPGKPEAVIVTRNQVTLRWTKP
QYDGGIKITGYVIEKKEGAGRWMKASFTNITETEFVVTGLIENQTYEFRVIAKNAAGVFS
QPSDSTGAITAKDEVDPPKIDLEVKYSQTVVVNAGETFKLEAAVYGKPVPTIHWLKEGQE
ITEAARLELKNTDFTACLVVKEAIRVDGGQYILLVKNVGGEKSVNINVKVLDRPGAPEGP
ISIYGVTNEKCSISWKPPLQDGGSDVSHYIVERRETSRLVWTVVEPKVQTLNLKITKLLP
GNEYIFRVIPVNKYGVGEPLESEPMVARNPFVTPNPPTNVEVSTITKDSMVVTWERPTND
GGSPIQGYIVEKRDKDGVRWTRCNKRNISELRFRVTGLLENHSYEFRVAAENAAGVGMPS
APTVYYKALDPVFKPGPPNNPKVVDTSRSTVSLTWGKPIYDGGCEVQSYIVEACNGASDE
WFMCTPPTGIMDTKYTVKKLLEKHEYQFRVCAINKVGVGEHADVPGKILLEEKLEAPDLD
LDADMRKMINIRAASTLRLFVPVRGRPAPEVKWGKADGEIKETAQIDNTGNYASLVIENV
DRFDSGKYTLTAENASGVKSVFISVRVLDSPSPPTNFVVKEITKNSVTLTWEPPHLDGGS
KIKHYIVEKRESTRKVYSPITTCNKMSWKVEPLPEGGIFFFRVLAENEYGVGLPAKTTEP
VKISEKPQPPGKVSVVDVTHSTVTLTWEKPLHDGGSRITHYEVELAPKDSEAWSICASVK
ALETLVTNLLKGEEYQFRVVAVNDKGKSDPRQLAHSVVAKDLVIEPAVRPKASSYSVQVG
YDLKLEVPVAGHPKPIITWTKDGVALKQTTRVNVTDSAQTTTLTIKDATREDGGMYTIGV
SNDLGSKDATVEVITLDKPGPPTGPVKLEDISAESITLSWEPPTYTGGCPISNYVVEKKD
TTTTNWSVVSATVARTTLKVSNLKTGTEYQFRIYAENRYGKSYAIDSQPVVAQYPFQEPG
PPGTPFVSSYTKDYMVVEWHKPPSDGGSAILGYHLERKERNSILWTKINKMLIQDCRFKS
TPLEEGIEYEYRVYAENIVGIGECSKVSEVYVARDPCDPPSRPEAVIVTRHSVKLKWNPP
AYNGGSLVTGYLVEKRDLPEGKWMKASFTNIIEHEFTVTGLTEDSKYDFRVIAKNAAGAV
SKPSESTGSITAKDEVVPPKSETDPMYNQTIVINAGETFNLEASVEGKPIPTAQWFKGNL
EVENSARAEIRNTDFKALLVVKDAIRVDGGQYTLVLTNVAGSKTIPFSVKVLDRPGPSEG
PLTISNVTEEKCSLSWLPPRHDGGASISHYIIQKRETSRLAWTVVCSDCKATMFKVTKLL
KGNEYIFRVMAVNKYGTGEPLESAPVIMRNPFVPPGAPQDLEITNITRDSMTVCWNRPET
SGGSDIVGYIVEKRDRAGVRWTKCNKRRVTDLRFRVTGLTEDHEYEFRISAENAAGVGQP
SPSTTYLKACDPTFEPGCPTNVHVVDTTRDSICLAWHRPIYDGGCEIQGYAVEITKADEE
EWAICTPPCGVNATKFTIKKLIEHQEYKVRICAINKVGVGEPTEIQGVVKPMDKIDPPEV
ILDSELRKGIVVRAGGSMRVCIPFKGRPTPEINWAKEDGELPSKVQVETGEDYTQLSIEI
CDKYDAGKYVLNLENSAGTKSAFVSVKVLDTPGAPLNLTVTDIKRESVTLTWEPPLIDGG
ARIKNYLVEKRESTRKVYSNVDNKCTKTSYRITGLTEGTIYYFRVLAENEFGVGQPAETE
ESVKTSEPPLPVGKVTLTEVTKTTASLSWEKPDHDGGSRIIGYYIEMQPVGSEEWVVAAT
CKTCEGTVTGLSAGHEYLFRILAFNEKGKSDPRPLAAPVTAKDITIEPKFKIQFNTYSLQ
HGEDLKIEIPVIGRPVPKVEWKKDGQALKETTRINVSSTLSCTKLYIKDANKDDSGKYTV
TATSSIGTATEEITVIILDKPGPPTGPVKIEEVSSNYVTLSWEPPEYTGGCPINNYIVEK
RDTTTTAWQIVSATIARTTIKVTKLKTGVEYQFRVSAENRYGKSSAIVSPAVIAQYPFSE
PVAPGTPVISSVTKDSMVVEWKPPTNNGGSPILGYHLERKEKNSLLWTKLNKLLIPDTRF
RTTELEEGIEYEFRVYAENVAGLSPASKLSESTVARDPCDSPGTPEPIEITRNHVTLQWT
KPQYDGGSAITGYVIERRKHPDTRWMKASFTNIIDTQFTLTGLTEDCVYEFRVIARNGAG
ILSQPSQSTGEITAKDEIEAPAATMDSKFKDMTIVHAGETFVIDADYTGKPLPEVIWLKD
GKEIDKATPRMEIKTTLTRTILTVKDCIRVDGGHFVLKLINVGGVKMIPVNVKVLDRPGP
PDGPLEVKGVTAEKCYLHWNHPSHDGGAGISHYIIEKRETSRLSWTMVEPKIQAISHKIT
KLLPGNEYIFRVTAVNKYGVGEPLESEAVVARNPFTTPSAPSNLEVGAITRDSMVLSWER
PNDNGGAEIEGYVLEKRDKDGIRWSKCNKKRLNDLRFRCTGLTEGHSYEFRVSAENAAGV
GKPSAPTPYIKACDATYPPGPPNNPKVTDHSSTTVSLSWSRPIYDGGAQITGYIIEMKEA
TDDEWIISTPHTGVQATNYTVKKLKENAEYNFRISAVNCEGVGEHVDLPCSVIAAEKLEA
PEIELDCDLRKMVNVRASATLRLFVTTRGKPEPEVRWSKADGTLNERAQIEVTSSYTMLV
IENVDRFDTGKYVLTLENLSGSKSAFINVRVLDSPSAPTNLGVKDVKRNSVSLSWEPPLI
DGGAKISHYIVEKREQKRMAFTSVCTNCVRNSYIISDLQEGGRYYFRVLAVNELGVGLPA
STDQVKVSEPPLPPGKIVVVDITRHAVTLSWEKPDHDGGSKITNYIVEMQPKGDDKWTVC
SEVKALEATIDGLTTGEEYSFRVTAVNDKGRSDAKPLATPVVVRDITMEPIINLLFTTYS
VKTGDDLKIDVPFKSRPQPEVCWKKDGQVLKQTTRVNVLNSKTSSKIVIKDATKEDVGKY
VITLTNSVGTKSAEISVIILDKPGPPSNIKVDEVSADFISLSWDPPTYDGGCQINNYVVE
KRDTTTTTWQIVSATVARTSIKVSRLTQGTEYQFRIAAENRYGKSPAIDSAPVVAQYPFE
PPGPPTQLHVVHATKTGMLVVWGRPASDGGSPVIGYHIESKDQSSILWTKVNRGLVTENQ
FKMTGMEEGLLYQFRVYAENIAGIGPCTRASDPVAARDPCESPHNLRVTNITRNSVSLFW
ERPEYDGSAKITGYIVERQELPNGRWLKCNFTNVQDTYFDVTGLTEDVRYDFRVIAKNSA
EQLSAPSESTGPVTVKDDVDPPTIILEDKFRQLVVIKAGEIIRIDAEITGRPLPVVSWSK
DGKEIEAKARCEITSTNFTTTLIVKDAIRRDSGQYVLTLHNVAGTRSVAINCKVLDRPGP
ASGPLTVSGLTAEKCTLSWGPPQENGGAEIMHYIVEKRETSRLAWTLVYGDMKATTCKVT
KLLKGNEYIFRVRGVNKYGDGESLESEPTKATDPFTVPSAPTNVQVTSVTSEAMTICWER
PVSDGGSSIAGYVIEKREKTGLRWCRVNKKPVYDLRVKASHLREGCEYEYRVFAENTAGL
SAPSTPCPLTRAEDPQFLPSPPAKPRIIDSTKTTVTLSWNKPLFDGGAPVTGYRVEYRKT
LDDEWIVGVQNTKNTEFTVVGLSPGTEYVFVVKSINKIGVSEPSPESDKQVAKEREEEPT
FDVSNEMRKTLIVKDGSSFTMKVPFKGKPIPSVTWAKPDVDLRVRAVIDTTDTFTSITLE
KATRNDSGKYTVTLSNVSGTSSLTLTVRVLDSPGPPSHIEVKEVTKTSATITWDTPEIEG
GGPVKNYLIDYREASKKGWTRLTDTCHRLTYKVADLQEGEVYYFRVTGENEYGIGVPAET
KEGTKITEKPSPPPKLGVTDVTKESVSLAWAKPEHDGGSRITSYLVEALENGQEKWVKCG
TTKSIHFTVSGLRENAEYFFRIRAENYAGFSDAKEMITPVVVKDQLESPEINMKDFPHNT
VYVRAGSTLKCEIPLTGRPLPKVTLSKDNVLLKSTMRFNSEVTPDSIKISVRESIAGDSG
RYDIIASNSSGTTKSFVNIVVLDRPSVPLGPVELYDVTEDSVSLKWLPPAYDGGSPITNY
IIQKRETTTANWMDVSSAVARCTMKIMKLTTGLEYQFRIRAENRYGISEHIDSPAVAVSL
PYTIPDVPSTPEITAVTRESITVAWKEPKSDGGSHVFGYHLQMKDKNSILWQRVNKTVIR
ATHFKVTNINAGLIYEFKVAAENSAGISAFSKISDAVLAIDACEPPLYLRITDITKNSIS
LAWQKPDYDGGSPITGYIIEKREGVSPKWSKANLTNITDTRFIVTGLTQDETYEFRVMAK
NAVGSVSNPSITVGPATCVDTYGAPEIEIPQEYLNEVKHKAGSNVELKFNIRAKPAPSIE
WFKDGRELKPTSQLSFKHTFESTSVFVKETTRLNSGTYEVKVKNSLGSSCAIVRLLIQDK
PGPPAGEIQFKKVTADNITIMWSPPADEGGAMVTHYIVEKRETSRVMWSIVSEKLVDCIV
NVPRLIMGNEYIFRVRGVNKYGIGEPLESEPIIAKNAFVPPSEPSKPKVTMITKSTMTVI
WERPALDGGSDIDGYYLEKREKRSLQWFKVVKGTIRDTRQKVANLVENNEYQYRVCAVNK
AGAGNYSEPSELYKAYDPIDLPGEPTKLRVVDSTKTSITLGWEKPVYDGGSEITHYILEQ
MNTEDKEWVITNPQVKTCEYVVSHLKPGIYYFFRVSAVNCKGKGEDIKMYQPVQAKDILE
EADLDLDVAMTTQYTAKAGRDVEVFIPLKGRPTPNVTWRRGDRNMAGDNRYTVTSTERAT
TLLIPKVTRDDCGKYVLEIENGVGEPKIVTVSLKVLDSPSTCQKLMIKNVTRGKLTLSWE
PPLIDGGSPVTNYIVEKKASTMKAYQVITDECLNTSYKVSGLEEDIAYFFRVSAQNEFGV
GDPCETTDAVRATETPGAVKDLIMVDSTKNSVTLQWSRPDHDGGSHITDYIIEKRAQDEV
KWTLAAKCKRCSCEVTGLKENAILDFRVFAKNEKGNSDFSQIGPITVMDLIIPPEAKLND
YPNGELAVRIGQNIHIELPFKGKPRPTISWLKDNFPLKESEKIRFRTTDNKTSVTVRGVK
KEHAGQYTLVLDNRVIKNYFDINVITLGPPSVPTGPIRFDEIKAQSIIISWDEPKEDGGG
EITCYSVEKRETSQANWKMVCSSVVRTTFKIPNLVKGTQYQFRVRAENKYGVSEPLISSD
VVAQHQYKPPGPPGKPVAYNITSDGMSIKWDAPDFDGGSPVLGYHVEKKDRNSLLWQKVN
STTISNREYRIIGLVEGLEYSFRVYAENNAGLSPCSEQSKHALAISPVDPPGTPVCIDVT
RDSVTLQWDIPKRDGGSKIVAYSVERRQGRGKWLRCNFTDISETQFTVTGLSPGERIEFR
VIARNAVGTVSPPSNSSGYIMTKDESIAPEIEWSPDQVLTLRAGDNVSLSCKITGRPVPQ
VLWYKEGKEIDKRTMIDIEITTGIGTSSLFIRDSNRNHRGIYTVEAKNSSGTRKADINVR
VQDTPGPVEGPIRFTGITAEKCTVWWSPPENDGCAAISHYVVEKRETSRITWALVTSKCE
ACSYNATNLIKGNEYQFRISAVNKFGVGKPLDSDPIIAKMQYTVPDAPGTPDATHVTGDS
ITLCWTRPRSDGGNEIKCYILERREKKSLRWVKVSSKRPITELRHRVTKLTEGNEYEFRV
MAENGAGVGPASSTSRLFRCREPTSAPSAPTVIKVIDSTKSSVTLEWTKPVFDGGMEIIG
YNIDMCKASLEEWHRVNRQICIHTRYTVTGLVPGELYKFRVSAVNGSGEGEASVMPNPVQ
SLDRLTSPEIDLGPDFKQTHIVKNGGTITLHIAFRGKPAPLATWSKLDSELPIMADINTT
DSFSTLTIENCTRYEAGKYTLSLENNSGRKSITFTVKVLDTPGPPGAITFKDITRGALTV
MWDAPATDGGSRIHHYIVDKREASRLAWQEVSTKCSRQMIRVTGLEIGVPYLFRVIAVNH
YGQGEPKEMTEPIIATEEPAPPKRLDVVDTTNSTASLVWLKPEHDGGSRIRGYIVEFRAK
GTDHWVVSGETKSQKMLVEGLIENTEYDFRVKAKNDAGISEPQGTFSSVVIKEPCIEPTA
DLSSITNQLITCKTSNTFTIDVPISGRPAPKVTWKLEEMKLKETDRVSIKTSKERTILVV
KDSKRSDSGKYYLTLENAAGVKTFTVTVVIVGRPSPPTGPVEISGISSESCTLSWSEPAD
DGGTDISNYIVEKRESGSASWQVVNSSVKRTTIKVTHLTKYMEYTFRVCAENKFGVSKSV
ESAPVVIEHPFVPPSPPTRPDVISISANAISIKWDVPYADGGSKVTGYWIEKKERNTILW
VRENKLPCLDCQYKVSNLIEGLEYQFRVYAMNLAGLSKASEASRPVVALNPVDPPGKPEV
TDITRSSVSLCWTVPFNDGGSKIIGYVVERKVYSTDEWDDNRWLKCNYTTITENYFTITN
LGEGETYEYRVVAKNAAGVQSVPSETTGPVTCKDEYSPPKAELDSKLIGETVTVTAGSDL
VLDGAVGGKPEPTVYWSKGDKILELGEKYSLTYTATRAMAVIKSCDRYDTGRYILTVKNA
SGIKTAAVSVKVLDTPGAPADRIVISRVTEEKCTVSWKIPLEDGGDSVTHYIVERRETSR
LNWVIMETECKTLSCVSTRLIKNNEYIFRVRGVNKYGAGVPLESDPIIARNAYTIPSQPG
TPEATAVGKEHVIIEWLKPESDGGSELKNYIVEKREKNSSRWTRVNKTYTIYDTRLKITG
LLEGSEYQFRVTAVNSAGYSQPSDTSVYILCKDPTYTPAPPSVPRITDTTKHSITMTWTR
PMYDGGSDVTGYIVEILEEGSEQWYRATAKALKTNEYVAAGLAANKKYRFRVAAINSNGT
GEFSEPSAEIEPLEKIEIPDLELADDLKKTVCLRAGGTLRLFVSVTGRPTPVVAWRKTGV
ELQSRGYIETTDKYTSLVVEKVDRYDSGKYIVEAENPSGKKTAIILVKVYDTPGPPGSVK
VKDYTKESVVITWDVPSIDGGAHVSNYIIEKREANMKSYKTVTTECRKTLYRISGLEEGV
YYFFRVLPENIYGVGEPCETAEAVLVCEVPSVPVKLEIVDVSKSSVTLHWEKPLHDGGSR
LTGYIIEACKVGSDRWSAVATVKASVSQHTIQSLTENDQYLFRIRATNSRGASESTDIVT
PVIIQEIKVMPKIDMTSIPQKIVHVNCGKPIDLNIPIRGRPQPVCSWYFGGVKLKDTLDR
IKIDSTSKYTHLVIRETTISDTGDYTLEVKNTIGMATEVIKVIILDKPSIPMGPVKIEEV
DGVSVTVSWLPPENDGGANVSGYVVEQRDAHRPGWTTISESVTRPCFKFTRLSEGTEYVF
RAAAMNRFGIGGFLQSDVVECKSAKTIPGPPSRPEVLDVTHEGMTLTWKPPEDNGGSTIA
GYIIERKEAHSDRWLRINKNPVTMTRYRSSGLIEGLEYEHRITAINSRGAGKPSESSVIT
IALDPIEPPGPPVQARVTDTTRTSVSLAWLPPEEEGGSVITGYFIEMQKVDQLEWTLCNT
TPTKMCEYIITHMPQGAEYKFRIIACNAGGCGEAAEIPGVVKVQEMLDYPDYELDPKYEE
GYVVRQGGVIHLSVPIKGKPIPTCKWTKDGRDISHRAMIATHDDITELVIKEAHKDDTGT
YDLVLENKCGRKAVYIKVKVIGRPDVPEGPLEFDDIQARSVRVSWRPPSDDGGADILGYI
VERREVPKAAWYTVDARVIGNSLVVKGLKENVEYHFRVAAENQFGVSRALKSEESVTPKT
PLCPPEPPSNPPEIMDVTKSTVSLSWARPRDDGGSRVTGYYVERREVSTEKWVRHNKTHI
TTTMFNATGLIPDAEYMFRVVAQNDIGQSEPGPASESVVCKDPFDKPNQPGEIDIVSVTK
DCITIHWLRPEHDGGKEILGYWIEFRQAGESAWKKCNKERSKDRQFTMGGLMEATEYEFR
VFAENETGLSRPRRTPMGIKTKLSVGEAPALTEDIQDVTTKLGESGTLTCGIIGRPLPEI
KWYRFGKELIQSRKYKMSSDGRNHSLSILTDEQEDEGLYTCRAINEAGEIESSGKLRLQA
APQFHPGFPLKEKYFAGAGTSLRLHVVYIGRPIPQIMWFYGKKPLNPSENVIIENTESYT
HLVVRNVQRKTNAGRYKVQLSNFFGTIDTVLRVEIQDKPCMPEGPLIVEALLKSSVVISW
KAPKDDGGSMITNYIVEKREAKEGEQWYLVSSSLSGTTCRVLNLTENAGYYFRVSAQNQY
GVSEPLEIPSVVIIKSPFEKPGIPQQPFIISSTKDSCVVCWKPPSSDGGAKITNYYLEKR
EKKQNKWMSVTTKKIAETNYEVTGLIEGFEYEFRVKCENMGGESEWSEISEPIIPKSDQP
PRTPTFREEIRDMTVKYHASATFVTKVLGYPKPVVKWYRSGKEILADGTKIKALEFKGGY
YQLVITSADENDATVYQVRATNSSGSISTTANLEVEVPAKIYLPQELQGMGAVHAVRGDH
ITIKIPISGKPEPTITWQKGQEILSNSPYHQVITTRSFTSLVFQKGVQRKDTGYYIITAK
NRFGMDKQTIEVNVADIPEAPKGLVVSEIARDSITLVWEPPVSDGGSNIINYIVEKCPTT
SDRWIRAGQTTDCSITIINIFGKAKYQFRVIAENQFGLSPPSEPTEPITTKEDKSVIRNY
DEEVDETREITKEEALFYKVKELSSKYIISEELAHCQFGVVHRCIEIATKKTYMAKFIKV
KGTDRELVLREIEALNVGRHKNIIYLHEYFESMEEIILIFEFISGVDIFERLGTSNFELT
EQEIVKYLRQVCSALKFLHSHNFGHFDIRPDNIVYTTRKSTNIKIIEMGQARLLVPGENI
RMLFSAPEYCAPEVHRHDLVTTATDMWSVGVMAYVLLSGLNPFAAESTTKMIENITNCEY
VFDSEAFKDISLEAMDFVDRLLVKDRKLRMTAHEALEHPWLKMKIEHISNKAIRTLRHRR
YYQTLVKRVDTIVSAARVAYGGAFKNQRGLAVGKVKIGTECHGFRAGPVMHASAEEGGYA
RFTCSIAKHDKSTQVSWYFGNCQLHTSHKYEITYSNGFASIYVKDIEESDDGVYRCKVLS
DDGEDSAYGELFVETVRSIKEYYLSRSIKKLRRRVDKTKLLQRPPEFTLPLYNRTAFIGE
DVRFGVTVTVHPEPCIIWLKNGEKIKPGDNDSKYTFTSDKGLYQLMIHNLDMTDDAEYTV
MAHNKFGEDSCKARLTVAPHPVTEETMKPMFKRLLANVECMEGQSVHFELRVSGVPPPTL
KWQKDGHPLQFGPKVVVIQEDVDSHVLHIRETLLEDSGVYKVTATNSAGTASCQATLKVD
RLTYTRREYRSEEEKYMHIQKQIEKTNKMAQKIVATEELVPLNPTAQEALKYAAEIYKPA
VSTKNVEGEFDIKEEKSETKKLEEERRIFMPYEIPEPVVHDPRVLDENKGIKLFVPLSDM
KWYRKLKDQYEISERMERIVQKRQKRIRLSRWEQFYVMPLPRITDQYRPRWRIPKLTLDD
LETVRPARRSPSPVSEALFRSRRRSLGDLSDEELMRTEEEEGMMLEDELELGFSASPAGS
PVRIERRAMEHEERRQEGRHETVEVAETKKKRTISQYMRRRRSLSPTYIELMRPVSELIR
QPHARHPVEVEGEIVGRRSPTPERTRPRSPSPIKSVERSSRSSSRFERSARFDIMSRYEA
RKAALKSERKYQLVSQTPFSLDHAPRVTVRMRSHRIPVGQDTKFTLNVQAKPEAEVTWFH
NGTAISESSEKFIFTNMTGVLTITILDCQEEDSGTYRCVCSNSKGEASDYATLEVSGGSY
TTFSSRRKDEEAPKAYVPEVTRTDHYHISHFKAGYASQTHFEVEETKSKLTETHEVFTHE
RYGASSERYSSAERYDSSIKYASAEYLSSSSSYSSDKFSLSGKHTISEAKLKSSTTAGDE
EVSVQKAKLSLPARILTKPQSVTVEEGETVRFTCDIDGEPAPTVTWIHESRTIVSSHHIQ
VTTTQYKSSLEISSVTASHEGSYTVVVENSEGRQEAHFTLTIHRATPKQEVKIVKPPEPS
VKSPTPSVKSPAPSATSPIPSTTSAVPSVKSPEPSTKSIEPSVTSPASSIKSPEPSATSP
APSVKSPTPSVKSPEPEGIKSPKTIKSPEPTAPSPAPSLKSPTPGVKSPEPEGPKSPRGL
KSPEPRLKSPPPTKTLGTGKSLESEEVKSPRGIKSPEPTGIKMPRGVKSPEPPGLKTPKG
IKSPEPAGIKSPRALKSPEPEGIKSPPRMKSPPPTMSPKRVVSPPTVKSPIPKPPKVMSQ
LTAEACEGSVRMSCVCESSVREVVWYVNGRRLSQSSRLEMHYSEGSCSLLIHNLTDSDQG
EYICEMKSEGGVSKSSFNFTGQVFQSIRKKITAYCEQQLGLQESVLMSQKESSSSLSSSV
MMKKEIHTMEESSAFSSTSQQAVMSSMTDSRSFSSMAAEMKFETMSMSSMSSVSSEAYAM
SSSSLMEMASHMEGSLRALGSAPRIEALPEDISIEPGKVLTVACAFSGDARHIEWSHDGK
RIELTAAGRFHIETTEDLTTLIITGVKKEDAGSYTLKLSNELGSDTATVHISIRSV
NT seq 86031 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacaagcaccgacattcacacagccgctacagagcgtcgtggcacttgagggt
agtgccgcgacgtttgaggctcaaattagtggttctccagttcccgaggtgagctggttc
cgcgatggccaggttctttccaccaccactctgccaggtatacagatcttgttcagcgat
ggccgcgctgttctgaggattcctgctgtgatggctgcacacagcggaaggttttctgtt
agagccacgaacggagctggacaagccacaagcaccgctgaactcctcgttacagtggag
acggcgcctccaaatttccttcaaagacttcagagtttaacagtgagacaaggcagccag
gtgaggctggatgtgcgagtgacaggaatcccaacaccagctgtgaagttctacagagaa
ggggccgagattcagagctcggccgacttcaggatcctccaagatggagacctgtatact
ttgttgatcgctgaagccttcccagaggactctgggacatattctgtgactgccaccaac
aacagcggacgggccacctccactgccgaattgctagttcagggtgaggaagctgtgcca
gctaagaaactgaagactgtttccacatcccaaatatcggcttcccagagcagagtacag
agggtggagactagtttccaggcctccactaagagggagatccatgtaggagaaggaatg
atcactcagcatttggctcacaaaacccccccacgggttcctccaaagccgacctccaag
tccccgccgtcctatgtttccaaggtgacggcaggacgtcagcagtccccttcgcctgtc
agacatgtgaaagggccaacaccgacacctgtcagaccagtgtctccatccaccaaactg
tctgtttctcccatccgaccagtcaagtctcccatcatgaccaggaaacaggtatctacc
tctgcagaggttctgccgccctggaaacagggagactacgcgactgaggcgagctatacc
agcatggcaagcatgaccgctgtcagcagcaccactcagcttcacatggagaagcactgg
gagcagcaggtggctgccaccagagaggaggtggctgcagtgcctacaagatcccaggag
cctgttgttccacccactcttattgctggactgaagaacctgactgtgaccgaaggtgag
tcagtgaccttggagtgcaaaatcagcagtcacccttccccggtcataatctggttcagg
gaggactacaagatcgagagctccattgacttccagatcagctacgagcacggatttgcc
aggctgattattcgtgaggcatttgctgaagacagtggccggtttacctgcactgccacc
aatgaagcaggaactgtgagcacctcctgctacctgcttgtgaaagtttcagaagaaatc
gaaagcagagaggaaacagctgtcacagaaattgcaatcacacaagaaaaaactgttgca
gctgaaacaaagctgcagacagtgacagagttgagcgcaggagaacctgcagctccgttc
ttcatcaagaaacccactgtgcagaagctagtggagggaggaagtgttgtgtttgaatgc
caggttggaggaaatccaagacctcacattatctggaagaagaatggcgtgctgcttacc
actggatacagatacaaagttgcctacaaggaaactggagaatgtaaactggagatctcg
atgacctttgctgacgatgccggagaatactccatctttgctaaaaatccccacggagaa
gcttcagcttccaccagcctgttggaggaagaggaatatgaagcacatatgaagcagcac
gatgtaacatataaaactgaagtgactacgtcagtggttcaggaaccctccgtggtcgtg
agtcagtatgaattggaacagaggaggacaataaccccgatgagctttgtctcagaaacg
gaattcctcatttcagcctttgaggagaggataatacagaagatcgaactgtgtatcatg
acaattacttacagagagcttgtggcagaggacggagagctggtagtgactatagcagat
gaggaggcagtgcagccagcctttgacacaccagtgaaaaactacaggatcatggaggga
gtgggagtcactttccactgcaagatggttggaaaaccactgccaaagattgcctggtac
aaagatggccagcgcatcaggcccagtgcgcgttaccaaattgaagttcttcaagatggg
cgagccagtcttcgtctgcctgtggtgctgccagaggatgaaggcgtgtacactgctttt
tccacaaacatgaagggaaatgcagtcagctctggaaagctttatgtggagccatccgaa
gctgtaacgccgcagagatacacaccacagccagcagtacagaggataagatcgacatct
cctcgttctctgagccgctccccagggcgttcttccagccgatctcctcgccagtctcct
gcccgtcgatttgacgaaacagatgaggctcagcttgaaagactatacaaacctgtattt
gtcatgaagccctcctcaataaaatgttctgaggggcaaactgcccgatttgatttgaaa
gttgttggcaggccaatgcctgacacatactggttccacaatggacaacaagtgatcaat
gataacacacacaagatagtgattaaagaggatggtactcagtccctgatcattgtccca
gccctaccacaagactctggagagtggacggttgttgctcagaatagagctggacgggca
tctctcaatgtaactcttactgttgatgctcaagaaaccctggcacgtcctcaatttgtt
gaaaagctgaaaaacatcactgtaaagcagggcactctggttgagttggctgtcaaagcc
attggaaaccccctgccagacattgtgtggctgaaaaacagtgacatcatcaccccacac
aagcatccacagataaagattgatggcaccaaaggagaagccaaattccagattccatct
gcttcaggctcagacagcgcctggtacactgctacagccatcaacaaggctggtagagac
accactcgttgcagagtcaatgttgaggtggactttgctgcccctcaaaccgagaggaag
ctcattattcctagaggaacctacaaagctaaagagattgcagcacccgagttggagccg
cttcatttgcgatacggccaagagcagtgggaggagggtgatctttatgacaaggagaag
caacagaaaccacaattcaagaagaagttgacatctatcagaatgaagtgttttggacca
gcccattttgagtgtagactcactcctattggtgaccccaatatggtagtggagtggctg
catgatggcaaacctctggctgctgctaataggttgcatatggtcaatgaatttggatac
tgcagccttgattatgaagttgcttatgctagggacagtggtgttattacttgcagagcc
acaaacaaatgtggagttgaccagacctcagccaccctgattgtcaaggatgagaaggga
cttgttgaggaaacacaacttcctgaaggcaggaagggagcatataggatggatgagatt
gagcgcatggctcctgagggaggacctgcaggagtcggcgctgatgaagaatctgaaaag
acaaaacctgatattgtcttgcttcctgaaccagcaagagtgctggaaggcaacattgca
cgattccgctgcagagtaactggttatccagcaccaaaggttaattggtacctcaacgga
caacttatccgcaaaagcaagagatatagactccgttatgatggtatttactatttagag
attgttgacatcaagtcctatgactcaggagaggttagggtggttgctgacaatccttta
ggaacagctgagcacacagtaaagctagagatccagcagagggaagactttagaactgtc
ctgcgtcgtgcaccagaaccaaaacttgcagaggctacacacgagcctggcaagattgga
tttgatattgtgaagatggaccgacctagtgaggcttcacaagacagggaagtggttaag
ctgcgtaagacacagagaattcttcatgagaaaacttcagaggagtctgaagaactgaag
agcaagttcaagcgcagaacagaggagggtttctatgagtctatctcggctgtagagctt
aagtctcgcaagagggatgactcttatgaagacctattgaagaagactaaagaggagctg
ctccatcatatgaaagagaaagaagaagctgaaaggaagaggatggaggaagagggtaaa
ctcactatccccacaataaaacctgaacgggtcctgctctctcccagcatggaagcaccc
aagatcctggaacgcattgcaagcaagactgttgctccaatggatgaggttcgtttcaga
gtcagagtagttggtagaccagaacctgagtgtcagtggttcaagaatggcattcagctg
gaaaagtctgaccgtatttactggtactggcctgaggacaatgtatgtgaattggtcata
agagatgtcgaaacacaagattctgctagcatcatggttaaggccattaatattgctggg
gagtcctcaagtcatgccttcctgcttgtacaagccaagacagcagttagctttacccaa
aacttggaggatacgagtgccaaggagaaggataccatggtgacctttgagtgtgaaacc
aatgaacccttcgtcagagtcaaatggtttaagaacaacacggagatcttctcaggagac
aaatacagaatgcactctgacagaaaagtccacttcctatctgtgctaatgattgaaatg
agggatgacgcagaatacacctgtgtgattgcagatgatgagaacataagaacgagtgca
aggcttcacgtggaaggtgctgctctcgagctcatcaaacaaatggagaacattgaggta
ccagaatcctatgctggcgagtttgaggtcgagttatctcgtgaagatgctgagggcagc
tggctctttggagacaaagttctctcacccagcaataaatacatcatatcgtcacgtcga
ggaagacacactttgtctgtcaaggatgtcaggaaagaggaccagggaaaatacaccttt
gtatgcggtgatctgaagaccagtgcctcactaaaaatgaaactgcgtccagtgacactg
atgcagcccctgactgatctgatagtctgtgagggtgatattgctcagctggaggtcagg
ttttcccaagagaatgttgagggaacctggatgaagaacggccaggccatttctgcctcg
gaacgtatccacattgtcattgacaagatggttcacaagctgctggtggagaatatcagc
acagaagatgctgccttgtactcttttgtggttcctgcccaggacatctccacctcaggc
aaactcagtgttcaaactattgacattgtagtgccactgaaggatgtatcctctattgaa
ggcacaaaggctgtcctggaggctaagatctctgcccaggacatcagctctgtcaaatgg
taccataatgacaaactgttgacacccagtgaccgaatccaaatggtggcaaagggagca
aagcagcggctggtcttcaccagaacctttgcatctgatcagggtcactataaactagtt
gttggcaaggttgacaccagctgtagcctgacggttgaagaggtacacattgtgaaacac
atggaggacaaagtgtgttcagagtcccagaatgtgacgtttaatgttgaagtctctcac
cctggaattgactcagtctggacattcaggaaccagcaaatcaaacctggacctaaatcc
aagattgagtcaaagggaaaggctcactctctgacagtcattgacgccatgaaagatgag
gagggccagtacatgtttcatgctggtgaaaagacatctagtgccaagcttactgtctct
ggtggagccattacacggcccctgcaggatgtgacagtggcggagtctcagactgctgag
cttgagtgtgaagttgcaaatgccaatgctgagggcaagtggcttaaggagggccagccc
attgacttcaatgagaatgtggtgagtgaggtgaacggagccatcaggcgcctcatcatc
aacattaccaggccacaggatgtcggagagtatacctaccaggtggccaactccaaaact
acagctaatctcagggtggagggagtgaagatcaagaaaactctgaggaaccagaccgtg
acggagacccaggaagcagtgttcacactggagctcacacaccccgatgtgaaaggatcc
cagtggattaagaacggggtggaactgcaaaacagcgaaaagtacgagatcgtctccagt
ggcgtggtccaaacgctgaaggtcaaggactgcaacatacaggacgagtctgtttactcc
ttcaaacttggaaaactttctgccaatgccagactcaacgtagagaaaatcaaaattgtg
aagaagataaaagatgtgacgtctctgttggatggcacagcctcctttgagatgagcctc
tcacatgacaacatccctgttaggtggatgtttaaaggtttggagctgaagtcaagtgag
aagtgcaagattctgtctgagaggaaagcacacaaactgatcctgaagaatctggacagc
agcgatgcaggagagtacgtggctgtggttggacacttgcagtgcagtgctgtactcacc
gtggaggctctgctggtcactaaacccatgaaaagtgtggaggtaccagagactcaagtg
gccacattcgagtgtgaagtctcccacttcaatgtgccgtccacctggctgaagaacgga
gtggagattgagatgagtgacaagttcaggattgtggttcagggaaaactccatcagctg
aagatcatgaacaccagcagggacgactctgcagagtacaccttcatttgtggcaacgac
caagtgtctgcaacactcaccgtcaacccggttctgatcacctccatgctgaaggacctg
aatgcccaagagagagacactatcacctttgaggtcaccgtcaactatgaaggcatcacg
tacaaatggctgaagaacggcgtggaaatgaagtcgtcggacaggtgccaggtccgcagt
cggcagcttacgcactccctcaccatccgaaacgttcactttggagacggaggagagtac
aagtttgtggccggctctgctgccaccactgctaatctctttgtcgaagctcgtgtgatt
gaattcaccaagaagatcaaggacataaagatcacagagaagaagaaggcgatttttgag
tgtgaggtttctgagccaaacatccaggtgatgtggatgaaggacggtcaggagatggac
atgtctgaggaaaggtatattgtgacagcagagaagtatgttcaccgcctcgtgatccag
acggttcgaatgtctgatgctggggaatattcagtggtagctggatcaagcgtctccaag
gcccggctcacagtggagggtcgcgacattcggatctcggaacctcctgagcgggaaatt
acggttctggagaaacaccgtgcaacctttgagtttgaagtgaatgaagaagatgtggag
ggtcactggctgaagaacggtgtggagatccagttctcgatggaagaacgatttaactac
gtgaccatcaggaagctgcatcgcctcaccatctcagagacctacaggagtgatgctggg
gagtacaccttcatcgctggcaaaaatagaagcaccatgcagcttcgaataaacatcccc
gagcctcctcagatccttcgccacatggagccccagtcggtggaggctggaaaaccagct
cgcttctcagtccaggtgagcggtgttccccagcctcaggtcttctggtacaaaaactcc
caggctctctccgctggcttcaagtgcaagttcctgcacgatggcaacgagcacacactg
ctgctcatcgaggtctttcctgaagacgctgctgtctacacctgtgaggccaagaacgag
tatggcactgccacaagcactgcaacactcaatgttgaagtttcagaggtggtttctcca
gactcccccgccactgttgctccccctgtcatcatctcacccatggccagcacttcagcc
tgcgagggcgcaccagcttgcttccagtgcaaagtccgtggagatgatgtgaagataagc
tggttccacaagaaaaaggaaatcaaacagtccgaattcttcaggatatctcagtttgat
gacagctgtcagctggagatctccagggtttatccagaggacgagggcgagtatacctgc
atggccacaaacaatggagggacggtgtcctgctctgcaactcttacattagacgtgact
cacgtgagagagcaggctgaaaccaagactgagctggaagtcaaagtgccccctgtcttt
aggcagaaaatcacacctctggagataaatgtcggcagtcacaccaagtttgaatgtgag
attgaagaagctccggacgtggcgttcaaatggtacaaatctggcaccgaaatcagacag
agtgaaaagtatcggatcgtcagccaccacactagttcctctttagagctcctgaaccct
gtcaaagctgatagtggagaatacacctgcaaagcttcaaatcaacacggcacagacagc
tgcactgcctcgctcattgtcaccgagatgtacccaccagtatttgtatcaaaaccagac
ccaatgactttatatgtgggaaaacaagctgtgttccagtgctcacttactggatcctcg
cctatggaagttgtctggcacaaggacaacataacaatttcctctgaagggaactatgtc
atgaaatgtgaaaagaacaagtattcccttcacattaaaagtcttgaactgactgatcag
ggagtgtacctgtgcaaggcttccaacagtgttggtgtagctactttttcagtagagctc
aaggttattgacaagccccggtttgttacggtcattgagccagtatctgcagctgttaat
gacccactgaggctggagtgccacgtgaatgaggacactggtgtggctgtcacctggacc
agggatggcaaaaaagtccaccagagtatggagtgtaaactgtcctttgaggacaaggtc
gctgttctggagatccccaagtccaaactaaaggactctgggaaatatgtgtgcacagct
gcaaacgaggctggcagctcctcctgtgaggctgtggtaacagttcaagagccccctgcc
tttgtgaagaaaatggaatctaagctcacgtggaaacagggcatagctgcacgcttacag
tgcacaatcaaaggatcgcctgaacttcacatccactggttctggaatgaaagagagctg
aataatggagacaaatataaaatatctttcaagagtggagttgctactgtggagatcatg
aaccttctggtcacagacagtggcagatacacctgtgaggtgtcaaataatgctgggagt
gaaagctgcagtactcttttagctgttaaagagccaccgtgcattagaaaagacctgcag
acagtagaggcagtgaagggagcagctgctcacctggagtgcgaggtcacaggaacagct
ccttttgaaatcacttgggtaaaaaataagaaacccatcaccagtgatcagaaatataaa
ttgatttcccaagactcaatagcaaggctggagattcaaacatttgacactacagatatt
ggagattatcagtgtgtcatatcaaatgatgtgggaaaagtcaccactaaggctatggct
aaacttaaagatccaccaactttctcaaaaagggttgagagtgttacagcagtcttggga
aatacagtaaaactacaaggaatgattaaaggttcaactcccatcactgtgaaatggatg
aaagactccaagatgctaagagatgatgatccaaatatcaagatggtttttgagaacggt
gttgtgagtttgtcgataacaacagttgccatcagccacggtggcaagtattcatgccaa
gcggagaacgaggctgggcaacaaaagtgtgaagcgatcttgactgtgcaagaacctgcc
aggattgtagaacctgcagagtccattagtgtgacggcaggggactcagccgcattggag
tgcacggtctctggaagcccagatctcaaagtgaaatggtttaaagatgggaaggagatc
attagtggccgtaaatataagatgactctgaaggataatattgccaccctgaaaattctt
actgcagaaaaaggagatacttcagagtataaaatggaagtggcaaataaagtcgggaaa
gaccagtgcacatgctcagtcactgtcttagatcggataatgcctccagctttcaccaag
tcgctgaaaagagttgacggtaacattgataatcctgtctccatggattgcaaggtgtct
gggtcacagcccatgaccgtgacttggttcaaagacgaccaggagattgtttctggagac
aaattccagcctgaatttaaagacagctctgctatactgagaatcatgtggctagaaaag
gctgactctggtgtttacaaatgcagagccaccaactcagctggctttaaagaaaccagt
ggcacgctctatgtgaaagaaccgccagcgttcacagtgaaaccacacgaccaggatgtt
attccaggaactacagtttccttaagaacagcattcactggaacagctcctttaactgtg
aagtggttcagggaagaaaaagacataattacaggaggcacttatttcattaaaaaagat
gcctcttcaagctctttggagcttcactctgtaaagcccactgatacctcgaaatacacg
tgcgaagtatccaacgatgctgggaaggtagactgcacggtagtcctctttgtgaaagaa
cctcccgtgtttgtgaggaaacccgaggcaaccaagctcatcaccagtggtgactctgcc
aggctggagtgcaaagtaactggcagcccagtcatcggtttcaaatggttcaaggatgaa
atggagatcagtgccagtactaaatacacaatgagcttgattgacttgatggcaactcta
gaaatagctaattgtacagtagaggacactggagattatgtgtgtgtggcatcaagtgag
gctggaagtgaccattgcacctgcacagttatagtcaaagaaccgccattgtttctgcgt
agcttggagcacagggacgtggtgaaaggttctgagctgatgctagagtgccaagtctct
ggttctgctccttttactgtgtcatttcataaaaactccaaattgattcggaacgacaaa
agacacaggattactgtgaaagatgacctgctagcacttcaggttctggtagtagaaaca
ggagatgttggtttgtaccagtgtagtgttgagaatgaagtgggaagggcctcctgtgat
tgtcacgtaacgctaaaagaaccaccatcatttgttcgaaagctggagaacctcagctca
ctggctggcagcgaggtttctctgatttgcagtctgaaaggttctgagcccataactgtg
gcctggctaaaagacaaccatgagctcaaagaggctgaaaacattcagattacatatgag
aacaagactgctctactgcagatcaccaacttacagagcagtcactgtggtaaatactct
tgccaggtgcagaatcaggctggcagccagacatgctctgctgtgctgacagtcaaagaa
ccagcaaaaatcacagaagaggtaaagtctatcagtgtgactcagggggatccggctact
ctggaagccaggttctcaggcacaaaacccctgaaggtcagatggctaaaggctggcaag
gagctgacctcaggccagagatataaagtacagagcaaagataccagttctgtgttgaag
attattaaaactcagaaaagtgatggtggtgaatatgtctttgaggtttcaaacgatgtt
ggacaaagttcgtgtgatgccacactcaccattctcgatcaaataattcctccgtctttt
acaagaaaactgaaacagacagagggtgtcaaaggatcatttgcgcatctggagtgtctc
gtgtctggttctcttccaataaccatacagtggtacaaagatgagaaagagatccagacc
gatgacaaacacaaatgcacattctttgaaaatgttccgtttctagaaatctccaatctt
gacactaaagacagtggcaattatacctgcattgctacaaataaagcaggaacggtccag
tgctctggagtcttatttgtgaaagaatcaccgtgcattcttgaaaaacctgaatccata
aatgttttgcctggctcaaaagtccaatttagtgtactgttctctggcacaccaccactc
accaccaaatggtttaaaagcagtaaagagatcctgtccagtgctgactggtcagtgatc
aaagataacacctcgagcacactggaactcttcttcgcaaaaaccacagattctggagac
tatgtctgccaaatacagaacgatgttggctccgcttcatgccaagcaacactctttgtc
aaagtgcctccaaagtttacacagatcccagcccgtgtgtctgtagtttgtcctggtcag
agtaaggtttttgagtgccaggtgaccggcacacctgagattgacatctactggttcaaa
gaaggctctgaaatcagccccactgatcactataagatggcctttgtcaactctgtggca
acactggaagtctgtggggctgaagttaaacatagtgggctttactactgcgaagctcgt
aatgaagctggcagtgagagctgcagcatggagttgaaggtcaaagaaccgccatcattt
attagagaactggctcgagctgatgttgtgaagggctccactgccatgttagagtgtcaa
gttgctgggacgggtccctttgagataacatggcacaaagatggaaaggagctcaaaccc
agtgctaaacatgccttctctcagttaaatgacactgtgtgtcttgaagtgcacaaatgt
gatgctgtagatattggtgaatatcaatgcaccgttgctaacgaggtggaaagctgtact
tgtaagactacactaagcctcaaagaaccaccaacattcatcaagacaattgagaacact
gctactgttctgggtaaaatggcagagtttcagtgcattgtgaaaggctctcccatcacc
tctgtacagtggaaaaaagatgagaattggatattggaggatccaaagattcagagaaca
tttgaaagcaatgtggctacactccggatccctgcctgtgaggcgatacacagtggcaaa
tacacctgccaggtggtaaatgaggctgggcaggataagtgttttgccgccctcacagtg
caagtgcctccgcagatcacagagaaacctgaggtggtaaaggttacagttggagatcca
gtcagtctggactgtaaggttacaggctcccctgaactcagggtgaaatggatgaaagat
ggcagggagctcaagtccatcaggcagcacaagctgatctttgagaacaatatcagcagc
ttaaagattcaggctgcgcagacagaggatgaaggagagtatgtctttgaggtggtaaac
tacatcagtagctgtacctgcaaagtcaagctaattgtattagagcaagtaattgcccca
agcttcatcaaacccctggtagacatgcacgagatattggggtcctttgttcagatatgt
tgcaaaatatctggttctctccccatctctgtggaatggaagaaagatggaaccaaaatc
tctagtggtctaaagcacaagctcattcagcaggacaactctgtgtccattgaaattgaa
cagctagagagagctgacgcagggttatactcttgcaaactgactaacgcagcaggaagc
tgtgaatgcagtgggtccatcgtggtcaaagaacctccaagctttgtgacagtgcccgag
tcgcagacagctctacccaaagccactgcacgcttcaaaggcacttttaagggaactcct
cccttcacagtcaaatggtttaaggacgacacagagcttatgactgggcctacttgttta
atagggcttgatgggctgtcctgtttcttagagctctattcagtgggcgtcacacagagt
ggagtctactcttgccaagtcagcaatgatgctggctccgtacactgtagtgcaaacctg
acagtaaaagaaccacctgaatttctactgaaactccctgccaataagtttttgaagcag
ggtgagtcactccgcctggagtgcaaagtcagtggcacagtccctctgaaaattacctgg
ttcaaaaacgacaccaaagttacagacggtggcaactacaggacgtcgtttgttgactca
gtagcagtgctagaactggtctccactagttttgaggatgatggagtttacacctgtgag
gctcagaatgatgctggcagtgtgagctgcagcactacacttaccattaaagacccccca
tcttttgtcaaaataccccagcctgttgaagggctgaagggtaaggacgtaagtttgtac
tgcgagatcagtggtacagctccattccagatcacctggtttaaagacagaaaacctctc
atggagagcaggaagtttaagctggtgagcgagggcagctcagccacactgcatgtcatt
ggaatagagccctcagacgccggcgaatacgagtgcaaagtgtcaaacagtgtaggaagc
gatacctgccagacatcaattaaactcagagagccaccatcatttgtgaagagactgtca
aacattacagtgatactgggaggggaggtgacccttgtggccactgttaaaggctctgaa
cccattactgtgtcctgggttcaagacaaggatcacattctcagggacagtgacaacagg
aaaatcacctatgaaaacaaccaggtggcagttaaaatctttaacgctgatgcaactacg
gcaggcaaatatacctgccaactcagaaacgatgctgggagtgtggagtgtttcgctaac
ttgactgttctagagcctgctaaaatagtggacaagccggatgctctgagtgtgacggca
ggtgatatggctgccctggaggtcaaagtgtgtggaaccccagagctcatacccaagtgg
ttcaaagatggtgctgagctggcttctgggagaaaatacaaaatctcattttcccggatg
atttcgagcctgaatgtgctgtctgctgagaaagttgactctggagaatacacatttgag
attatgaatgaagttgggaaggacctgagtaaaatcaatctcactgttttagataagacg
attcctccaacattctcacggaaactgaaagactgtaccactgttgttggaaaaccttta
gaaatagagtgcaaagtgtcaggctcatctccttttaccatttcatggtaccacaatgac
gaggagataaagagtgggccaaattatgagatttcattcagtgacaacaactgtacacta
agggtgctcacgctgaagctggctgactctggagcatacaaatgtaaggctgtcaacaag
gcgggaaccacagaaactacagccttcctggttgttcgagaacctccaacgtttgtggtg
ccaccgcagccagtggaggccatgccaggctctaatgtgatgttctcagccatggtgaaa
ggcagcgcccctctcaaactcaagtggttcagagggacgaaagagatcgtagctggacat
ggctacgatttctccctggatgataacaaagttctgttagagctttacaacgtggacaaa
tctcatgctggagagtacacctgtcagatcattaatgacgcaggaaaagaaagctatcca
gtgaatctcactgtcaaagagccagcaactttctcaaagaagctgaaggacatatcagtt
gagaagggcaaaccattaaccctggagtgtacatacacgggcactcccatgatcactgtg
agctggtacaaagatggccagcagatctttgcttcatacaaatacaacattaccacaaca
gaaagctcctgtatcttagagtgtctgagcactgatgacaaggaggctgcaggaaaatac
tgctgccaagtgtgcaacgatgctgggaaagacacgtgtgaggcagtggtttctatcctc
gagccaccatattttactgagtcactggagcccatggaggtgacagctggagatgctgtc
tgtctgaaatgtcaggttgcaggcacacctgagatcaaggtgtcctggttcaaggctgat
ggcaaagtcaggtctagccccacctgcaagctggagtacacaaagggtgttgcctgtttg
aagctaagtaaagccaccaagtccgatatcggagagtacacctgcaaggcagagaacagg
attggctctgcttcctccagctgcagactcaatgtgcaagaagctaaaacgccaccatca
ttcccaaagaagatcaccagcctgcagcaaactgagggccagccagtgcgctttgagtgc
cgcgtggctggctcattgcccatcgaggtgtcctggctgaaagacggcaaacctctgagt
cagggggaggagttttccatgctgtacgatgataacacagctgttctgcagatcaacaac
agtgagatgaggcactctggggagtacacttgcgtggccaccaacagtgtgggctcagct
tcatgcagagccaagctcactctgcaagaacccagataccctccggtatttgacaggaaa
ttgtcactacaggaggtgacagtgggtgacagcattgagctggaatgtcacatgactggt
tctacccccattaaagtcacttggtccaaagaccacaaagatattcgctctggggggaat
tataagattagctgtgtggataatacacctcacctgaccattctgaaggcagataaatca
gatacagggaggtacttctgccacgcctctaatgacatggggaaggactcttgttcctct
gatatcactgtcaaagagcgcaaaaatcctccagtgttcaccaaaaagccctcagagcac
atcgaggacatggagggcaaactggtgaagattgagggccgagtctccgggtcgcagccc
atttcagtcagctggttcaaagatgacatggagatacagagttctgacaagtatgacatc
agctttaagagtaatgtggcagtgctgtgcattaaaaacagccaagtgattgacagcgga
aggtactcgtgccaggcctctaatgaagctgggaaagcctcctgtgatgtcactgttggc
atctcagaggccaagaagcccccagtgtttgacgtacctctcaaaccagcaactgtggat
gacggcgaaaagctaattctcaggtgccatgtctgtggatcttcccctctgaagatccag
tggatgaaggacaggaaggagttgacaccatccagcagcactagaatcagcttttctgat
ggcacagcatgtctggagatcagcacagtctctaaactcaatgctggtgactacctctgc
aaggctaccaatgaggctggcagcgaattctgcaaagccaaagtcactgtcaaagagaaa
cctggagcagctctgtctcctgctgaagctccagcagcttctccatccaaaaaactggac
aatctgttcttcattgaagagcctaaaactgcacacgttaccgagaagggaaccgccacc
ttcatcgcaaaggtgggtggtgaccccattcccagtgtgaagtggatgaaagggaagtgg
aggcaagtgacccatggtggccggatctccattgaacagaagggccaagaggccaaactg
gagatcaaagaagtgacgaaatcggactctggtcagtacaggtgtgtcgcctccaacaaa
catggcgagatcgagtgcagtactgacatgcacgtagaggaaaagaaggacgtagtgatg
cttgagggagacctccgcgctaaactgaagaaaactccatcaaagcaaaagagcccacag
gaggaaaaagacattgacatagttgagctgttgagaaacgtggacccgaaagagtatgag
aaatacgcccggatgtacggtatcactgactaccgaggtctactgcatgcaattgagcag
ctcaaaaaagagagagctgaagaaagtggaagacaagaggtagaccgtggagacagagag
tctgatgaggacatggccaggctggtggctgacctgcagaagaggatggaacggactgag
cctgtcactgtggtgaaggacatttccaatcaatctgtcttcattaatgaagaagcagtg
ttcgagtgtgagatcaagatcaactacctagagatcacgctgtcctggtacaaaggcaca
cagaaacttgatactagcgacaagtacaatatcaccatcagcggcgaccgccatctgctc
aggatcaagaactgccagtcatctgaccagggcaactacagggtggtgtgcgggccccac
atatccagtgccaagctcagtgtcatggaggtggaggttgagaaacatctacaggacaca
atgggtaaggaaggccagtcatgtactatgtcttgtcagatgtccatccctaatgtagag
gctcagtggtttaaaaatggaaagcagttagaaatgaaggacaggtacacatctgaggtg
aaacacaaggttcagaagctactgatcagagacctgaagcctgaagaccaaggaagatac
acctgcaagtaccaacagctggagtcttcagcagacctctgggtggaagctgaacaaatt
catttcaccaaacgcatccacaacatcgaagtcaatgagcgacagtcagccacctttgag
tgtgaagtgtcctttgacaatgccattgtttcatggtacaaagacacctgggaactgaaa
gagagccctaagtacaacttcagaagcgagggccgaagacatttcatggtcattcaaaac
gtgaccgttgaagacgaaggcgtgtactcagtaattgtgaggttggaacccaggggagag
gctaagagcacagctgagctttatttgtctggcaaagaaattgaattagcaatggtcccc
attgatatgccagattcctctgttcagaggcctgaagtgcctacgtcagttgcaattcaa
gaatcttatgaattctatcattatgaagaagagattgaagcagttgtaagagttgccatt
gaggagacaatggagaccaaacaagttcaaatgagagaggaaatcccaacaaaagttgag
gaaaggcctgaagagaaaccaacaccagcatcaccacagagagagcctgaagccagaaag
caagtggaggaaaagattgctgtggtttcagtcccagaaaaggatgttcctgttcccaga
gaaacagaggaagttaaaaggccgactgcttccccacctccacctactgagaagcctgga
gtgccaaagaaagatgaacccaagcctcaggtgccagcagactccaaagtagtggcccct
gaagctaagcctgaagctgagcccaagcccaaacccaaagcagaaccagaagcaaagcca
gtgcctacacccaaagcggaaccagaagcaaagccagtgcctacacccaaagcagaaccc
aaggttaaacctgaacaaatccccgagcaggagcctgaagctaaaccagtaccagtaaag
aaaatggtgacgccaccatccaaagtccctgaagaagctgcaaaaccagatccatcaaag
accaggcgcaagccagctgaaaccaggctagaaccagacaaacctaaaccagaagctcat
aaacccgagccttctctaacaaaaccagaaccaaaagaacctgcagtggttcccaagcct
gaacctgtggtgaaaaaatcagcagaaataacagcaccaaagcctgtggtgccaaaaccg
gaacccccagtgaccaaaccagaaccaactcctgcaccaaaggaacctgcaaaaaaagca
tcagaagaaccagcaaagaaggaggtttcagctccaatccaaccaccccaaccttcactt
gcacaaccagaaaagtttgagacagaggagcaagcgccacagaagaaacctgtggcagtt
aaagttcctgtggaggaaaaaataactgagcttccaaaagcagccaagaaagcagagcct
gctgtcgttccaccaaaggaagaaccaacaaggaaagagaaagctttgaagctcgaacct
aaacctgtacctgaaaaaagctatcagaaggtgtttgatgaggttgctgtgttggagcct
gaacctgtgaagcttcctgagaaaatatctgaatcagtacccgagagacgcttggagaaa
gtgctgaaacccgagaaagccatgaaggaaattccaaagctggagccagaaaaattacct
gagaaagtaccagaaaaaccacgtgaggaaaaagtcccagaggaggctcttcctaagagg
aagcctgtaaaggttcctcagaaggtggttgaagaagctttgattactgagaagcagaca
tctgtaagcactgaggaaatcaaagttgagctcatttcaaagaagcaaacagagaagatc
tctgtagagaaaacagttcacgtaaaggcccctgatgcaatacctgatattgtatctaag
gccaagcctaaacaagaggtagaagaaattcttcctaaagaaaccgaagctaagaagact
gagaggattctgcacacagagattgaagaggatataaaaatttatgctactaaaaaagta
cttgtaaaggagaaggagttggtgccagaaatcaaagaatcactggtaaagccagctgct
ccacaaaaagtgagcaaaccacaagctgctgttaaagatcaagaagctgccaaaaagcct
gaagtcactgataatgccaagttgaaaaagacaattactccaccagaagaaaagccagtg
gtcgtgacaaagcccgttatggcggctgaagaaccaactaagatgattgcagaggaggaa
aaaccactaacaaaaaagatatcacctggaacagatgaatccaaggggccagtccaagca
ccaggaggagtcaagaaagagggacaaccaacagaggaagcaggaagaggtagaggtaga
gggctgaaacctaagcagaccccatctcctggagagggcaggggtcgggggctgaggcct
ggtgggaaaggaccaccaccaccagaggaaccttttgcagggttcaagctcaaagctgtc
ccgctgaagtttatcaaaaagcttcagaacattgttctgcaggaagccgagtctatcggc
tcatctgctgtctttgaatgtgaggtctcaccttccactgctgttacttcttggatgaaa
gatgatagcaatctccgtgagagccccaagcacaagttcacttcggatggcaaagatcgc
aaattgaacatcattgatgtccagctgtctgacactggggaatatacgtgcgtggccaag
aacgctggcaaagagatatcttgcaccgccaagcttatcgttgaagagctacctgtgaaa
tggatcaaagaactgggagaggagacatcagcaatcaagggtcagcctctgtatatgacc
tgcgagctgaacaaagagagggatgtgatatggaagaagaatggtgaggtcctcaagaaa
aaggagggcaagattcagatcaatatcattggtatgcagcacgcggtgaccatccagaac
tccacggaggaggacgccggtgttttctcatgtgaagtggctggacaggaagacgttaag
actacaacaaacgtcaaagtgattgaaattgtcaaagactggatagtgaaaccactgaga
gatcagcatgtaaaaccaaaggctgctgcaacatttaaatgcgagcttttcaaggaaact
cccaactggaagtggctcaaaggagagaatgaagtccagccatctgacaagattgagatc
aagaaggaaggaaaggagctgacgctcgtcattaagaactgccagcctgatgacgtagca
gaatatgcgctggaggtggaaggacgcatctacactgccaagctaacacttggagagcgg
gaggctgagatcctaaagcctttggtcagcgtcgaggtggttgagaaggaagatgccatg
tttgagactgagatttctgaggacgacattcctggggaatggaagctcaaaggagaggtt
ttgaccagatccccgacatgcgacatccaaatggagggtacagtgcgtagactcaagcta
aaaaactgccagctggaccaggcgggagaagtgacctacacggctctgaacgccataacc
agcgccatgcttaatgtcaaagaacgtgacatcaaggtcgtccgcccactgtacagcgtg
gaagttacagagaccgagacggcgaagtttgagacagagatttctgaggaggaccttcat
gccacctggaaactgaagggcgagacacttcatccgtctgctaatgtggagatcaaggag
gaaggaacccggcacttattgatcctctataactgcaaaatggacatggctggaagtgtt
gactttgcagcagcgaatgccaaatcctcagctcagctcagggtcaaagcccgagtgatt
ggcctccagaggcctctgaaggatgtcaccgtgactgctggggagactgccacctttgag
tgcgagctgtcatacgaaggcatcgctgtcgagtggttcctggggggtacaaagctggag
ccaagcgatagagtggtgttgaaggcggagggtaaagtccacaccctgactctacgcaat
gtcgagcaaaacgaagccggacaaatcaaactcgcagccaaagacttccagactgaggcc
agtcttactgtcaaagaaccaccagtggagttcactaagcctctggaggaccagacagtg
gaagaggaggccacggccacactcgaatgtgaagtttccagggaaaatgcagaagtgcga
tggttcagggatggacaggagatccgcaagacaaagaaatatgagatgatcgttgacggc
tgcaagcgagcgctggtcatccacgactgcactttggacgactcaaaaacatatgcttgt
gatgctaaagacttcaaaacctcatgcttcctcaatgttgaacctccacacattgagttc
tcaaagccactccacgacgtcgaggttgtagagaaggaatcagccaggtttgaatgtgaa
gtgtccagagaagacgtcaaagtccgctggtttaaggacggaaatgaaatcagaaaggga
aagaaatacgaaattattgcacaaggtcgccagcacatcctcatcatccacaagtctgtg
tttgacgatgaggctgaatacgaatgtgatgcaaagacctcaaagtcctctggcatgctc
actgtcgttgaggaggagacaaggttcaccaagaacctgttcaatgtggagggaactgag
actgacagtgtaaaacttatttgtgaagtctccaaacccagcgcagacgttatctggtac
aaaggagacacggagctgccagagggtggccgctatgagcaaattgtagatgggaagaga
aggatactcctgatcaaggatctgaacatgtctgatgctggagagtacaactgcaggcta
agttccagcaacaaaacttcaggaaacctcaagattaatgaattagctgctgaattcatc
tcaaggccacaaagcctagaagtggtggaaggagagaaggcagcgttcacgtgctccgta
tccaaggagacctatgaagtcaaatggatgaaggatgacgtggagctcgaggccggagag
aaataccagatagtcaccgatggcaagaaacgaatccttgaaatcaaggactgtgaactt
aaagatgagggtggatacatagttatgattggaccaactagagccagcgccgaccttact
gtgctcgagagactgaaaatcatcactcctctaaaagacacagagggcaaagaaggtcag
gaggtcgtcctgaactgtgaggtcaacacagagggagcaaaggccaagtggctgaagaac
gacgacaccatatttgagagcagcaagtacgtaataacccagagagacaatgtcttctcc
ctgagaatcaaagatgtccagaagggagacgaatccaactacagcatcaacttgaccaat
cagagaggagagcatgccaagagcaactgcagcctgaccatcagggaggagagtctaaga
atagtggttcccccggaggacattgacactcaggagaagaagaccatcagcttctcttgt
aaggtcaacaggcccaatgctactctgaagtggatgaaggccggtgaggagattaccctc
agcaaacgcattgtctacagagttgacaaagacaagcatactcttaccatcaaagactgc
accctggccgatgagggtgaatacacagctgtagccggagatgacaaagccacagcagag
ctcatcatcagcgaggcaccgacggatttcaacgtgcacctaaaagaccaaacaatcacc
gagttcgaggacgcagaatttacatgcaagttgaccaaagagaaagctgaagtcaagtgg
tacagaaatggccgagagatcagagaaggacccagatacatatttgaacgagatggaaag
atttgcactttgcgcatcaaggaatgcagacctgatgatgaatgcgaatatgcctgtggt
gtggaggagaagaaatccagggccaggctttttgttgaagagaccccagtggaaatcatc
agacccccgcagaacgtgtttgaacctccaggctcggacgttgtatttgaggtggagctc
aacaaagacagagtggaggtgaagtggttgaggaacaatatgaccgttgtccagggagac
aaataccagatgatgagcgagggtaaagtccacagattgcaggtctgtgagatcagacct
cgggaccagggagagtacagagtcattgccaaggataaagatgcaaaggccaggctggaa
ctggcagctgtgcctcagataaagaccactgaccagaactacgtcacagatgttggaaag
cctgttatcatggtcgtcccctacagtgcctatccacaagctgaagctgactggctgtac
aacaacctgagtctgcaaaaagacaacatctacacctcagctgagcacacagagtaccga
ttaaagaaccccaagaaggtcgacgagggctcctacaagatcatcatcaaaaacaaacat
ggagcgggagaagctttcatcaacctgaatgtcattgatgtcccaggacctgtgaagaac
ctccaggtgactgacactgcagatggtgagatcagcctcgcatgggaggagcctgagagc
gatggcggcagtaaagtcatcggctacatagtggagagacgtgatgagaaacgtaagacc
tggacactggccaccgaccatgccgaaagtcctgagtacacagtgaccggcctccagaag
gagtccaagtacctattcagagtctgtgcccgaaaccgggttggcagcggacccactgtg
gagactgacgaagctgtgcaagctaagaacaagtttgatgttcctgaagctcctctgaat
gtgatcgtgggaaacgtcaccaagtttggctgcactctgtcttgggagcctcccacatca
gatggaggctctcccattacctcttatatcattgagctccgcgacaggacgtcagtgaag
tggtctcctgtcctggtggccaaacctgatgacctcagtgccatcattaatgatgtcatt
gagaataaagagtacatttttagagtgaaagctgagaacagagccggtgtcggcaaaccc
agtgctgcctcacagcccgtcaaaatcatggatccaatcgagcgtcccagcccccctctg
aacctgtcctgggaggaccagaacaagagctcagtgcagctcacctgggagactccactg
aagaacggaggcagcatgatcaccggatacatcattgaacgctgtgaggacggttctgac
aagtggctccgctgcaacgcccgtctctgccctgacctcttctacaaggtgtcaggtctg
aaatatgggactaagtacaactacagagtgtttgctgaaaacgctgccggagtctctgag
ccttcaaacatcatcggacctctgctagctgacgacccacatgttggtccaagctttgac
ctgagtgcttttaaagatggcctggaagtgattgttccccagcctctcaccatcagagtc
cccataactggatatccaatacctgttgctaagtggaccttcggagagaaggagctatcc
agcgtgcatgatgagcgggttttcctcatgacaaagtcaacatttacagaactaatggtc
actccgagtgtccgtccagacaaaggcatctacacgctacatctggagaatgatgtcaca
tcggtctctggagagattgaagtcaatgttattgctgcacccagtgctccaaaggacttc
aaggtccttgaggtgactcggcagcatgtccacctgagctgggaggctccagagcatgat
ggaggaagtcctctgattggctaccaggtggagaaacgagacgtgtcccgcaagacctgg
gtcaaggtgaccacagggatccaggatctggagttcaccgttactgacgtggttgaaggg
aaggagtatttgttcagagtcaccgcctgcaacaaatgtggaccgggagagccagcgtat
attgacgagccagttaacgtctcctctcctgcaactgtccccgaccctccagaaaacctg
aggtggagggacaagtcagccagtggcatcttcctgacctgggagccgccaaagtatgat
ggcggaagcggcatccggggctacaatgttgaacgctgtcagagaggaacggataagtgg
gagccctgtggggacttggtacctgagctgaagtgccaggtgacgaatcttattgagggt
cagtggtactcttacagaatcagagccctgaaccgacttggagccagccggccctgcaaa
gccactgatgagatccaggctgttgatcctaaagagcctccagagatccagctggatgcc
aagcttctggctggtctgactgctaaggctggcagcaagattgaacttcctgctgatgtg
acaggtaagcctgagccacgagtcaagtggaccaaagccgacctggtcctcaaaccagac
gacagggtgtccatcgacaccaagccaggacactccatggttaccatcgccaagacaaag
agagatgacagttccacttatatcatcgaagccaccaacagcagcggtcgtgccactgcc
actgtggatgtcaacatccttgataagcctggtccccctgctgcttttgacatttctgaa
atcaccaatgagtcctgctttctggcttggaaccctccacgtgatgatggtggctccaaa
gttaccaactatattgttgaacggcgagctgctgatagtgagatctggcacagactgtcc
tccactgtgaagctgaccacatacaaagctaccagtctgatcaagttcaaagactatatc
ttcagagtatttgctgaaaaccagtttggtgttggtccagctgctgaacacccatcaatc
actgctaaatacccctttgatactcccggggctccttacaagctggaggcttcagatatt
gcaaaggactctctgaatctgaactggtatgagcccgatgaggatggaggaagcccaatt
actggatactgggtggagagatacgaagctgaccatgacaagtggataagatgcaacaag
ctgccagtcaaagacacaaactacagggtcaaaggtcttccaaccaggaagaagtataag
ttccgagtccttgctgagaatctggccggaactgggaaacccagcaaggagacagatcca
atccttgttaaagatcctattgaccctccatggccccctggcaaacccacagtgaaggac
gtagctaagacgtcatgcttcctaatgtggaccaaaccagagcatgatggcggagcaaag
attgatagctatgtcattgagatgctaaagaccggcaccacggactggatccgtgtggca
gagaacatccccatgctggaatatttcctaaagggcctgatggagaagcaggagtactcg
ttcagagtgcgagctgttaacgtggctggagagagcgaacccagtgaacccagtgaccca
gtgctctgcaaagagagactcaaccctccctcagctccacgctggttagaggttgtcaac
atcagcaggaacagtgctgagctgaaatgggcggttcctgagcgcaatggaggttcagcc
atcaccaactacattgtggagaaacgtgatgtgaggcgtaaaggttggcagactgtggac
accacagtcaaagagctgaagtgcgacgtgaaaccgctcaatgaagggtcgctttatgtg
ttccgtgttgctgctgagaacgctgtgggtgtcggacccttctgtgagatggaggactct
gtgctggcaaaagacactttcagtactcctggcccaccctacgctctcgctgtcagtgct
gtgaccaaaagatatgtggacttgcagtgggaggcaccgaaaaacgatggtggaagaccc
atcctcaggtattccattgagaaaaaagagaagcttggaactcgctgggtgaaatgtggg
aagacctcgggtccagactgtaagtacagggtaacagacgtcattgagggaacagaggtt
cagttccaggtccgagctgagaacgaggctggcagtggacacccaagtgaacccaccgag
attctcaccatagaagatccaacaggcatcccatcaccacccattgaattacacgtgact
ggagccagccgagacttcctggcaattgcctggaaacctccacaaacagatggcggtgcc
cctgtcagaggataccacattgagatgtgcgaggctggaactgagaagtggatgagggtg
aactcccgtccagtgaaggagctcaagtaccgtgtagaggagggtgtgacccctgaaaag
gagtacattctgagagtgagggccgttaatgctatcggagagagcgaaccgtcggacatc
tctgaaaatgtctttgccaaagactctgactgcaacccaactctggaattccagactctg
gatctagttgttgtggaaacagaaaagctgcacatcccagttccctttagagcagtcccc
ttacctaaaatcacctggcacaaagatggcaaagagctgaaggcggatgaacgccttggc
tttaggaaggagtatacctcctgtcacctggagattgacatcagtcttcatgccgatgct
ggagtgtacaaagtgacactagaaaacaagctgggaagtgccagtgccaccatcaatgtc
aaagtcatcgggcttcctggtccttgcaaggaaattgtggcttctgagatcacaaagagc
tcctgtaaagtttcatgggatccaccagattatgatggtggtagtccaattcttcactat
gtcttgcagcggcgtgaggccggcaggaggacatacgtcaacataatgtcaggagagtgc
aaggtgagctgggtggtcaaagatctcatccacaatggagagtactacttcagggtccag
gccgttaacaagattggaggaggagagttcatcgagctccgcaacccagtcatcgccgag
gaccagaaacatgctcctgacccaccagtggatgtggaaacccacaacccaacatccagt
actgttactctaacctggaagcctcccatgtatgatggtggctccaaaatcatgggctac
atcctagagaagcagcagaaaggagaggacaagtgggagaggtgcaatgacttcctggtg
cctgtactatcctacaccgtcagaggattgattgaaggaaagaacttcacctttagagtc
agagctgaaaatgctgctgggatcagtgagccatcacgcaacacgccatttatcaaggcc
gctgataccattgatcctccaaaggttttcctgagtggcagcttgcagtctggtctcgcc
gtgaagcgaggctacgagatctgcctggatgccaacatttcaggatctccgtaccctcag
atcacctggtactggaacaaccaatcaattcagcctgagccactccggaagagacctgaa
aaacccctgaagaagaaggtggaaaagaaggaagaggaaaagaaggaggaaaaggagaaa
gaagaggggacagctgagaagaaagaggagaaggagggagaggtgaaagaacctgaggaa
aaagaaggcgaggtgaaaaaagaaggcgaggtgaaaaaggaggaggaagttccacaacca
gaggtcgaggagccagactaccccaccataaatgaacgcctggccatcgacaatagccac
aagggtgtatcctctatcgttatcagggactcgattcgccctgatcatggtgtctacatg
gtgaaggtggagaacgaccatggcattgcctcggcaacctgcgaggtcaacatactcgat
actcccgggcctcccgtaaactttagattcgaggaggtgaggaagaactctgtgatctgc
aagtgggatccccctctggatgatggtggcagcgagattctcaactacaccctggaacag
aaagacaactccaagctggagattggttggagcaccgttaccgcaatattgaaaggatgt
cgttacttggtgcccaaactcattgaaaagaaggagtacatctttagggtcgtggctgag
aacaagtatggtgcaggcccaccctgtgtctccaaaccggtcattgccaagaatcctttt
gaacctcccgaagcacctgataaaccacaagttgatgacatcacagccaatagcatgttg
gtcacatggaatgaaccaaatgataatggcagccccatcttgggatactgggtggagcgc
cgtgagatcaacagctcacactgggcacgtgtaaataggaacatcatccctgtccctgag
ctaaatgttgaaggtctgatcgaggggctgacttacatctttagagttgctgccgaaaac
caggccggccctggaaagttcagtgttccctctgaacccaagactgcccagccagcaatt
ttgcctccaggtcctccagttgcccgagtggcagcaactactgaccactccatcgaagtt
gagtgggacccgcctgctgacaatggaggtggggaaatcctgggatatcatgtggataag
gctatggctggtaccaaggactggtcaagatctacggaacgtccgtggaagactcggaac
ttcactgtttatggagtcagagagggagcaaagtacacggtcagagtcattgcctgtaat
gctgctggagagggaacaccaggattcacagagtctgtattcgtcagaaatcctgcagag
atcccagtaattgaattggatctgtctgtcaagaatggcgtcgtgatcagagctggagaa
aacctccttatacctgctacagtcacaggtaaaccctacccagccatcacctggaccaag
gatgatggcaaacccgacaaagaccgtgcggagatcctcactgaggacaacaacagcatc
ttttcagtcaagaatgtccagaggaaagactgcggaaaatatcaaatctccgcttgcaac
cccagtggcatcaagtctgcatggaccagagtggaggtcatggatgtcccgggacctgtc
acagacctgaagcctgttgttgtcactcgtaagatgatctttctgaactgggatgaccct
gaagacgatggaggcagtgacttgaccggcttcctcgtggagcgaagagatcccaagatg
cacacatggaggcaacctgttgaaaccgcctcgtccaagtgtgagtgtgtgggcattatg
gagggacaagaatacctgttccgtgtcatcgccaagaacaaatacggcctgggcccacct
gttgagctaggacccatcaaggctgtagacccacagggcccgccatcatatcctgagaag
ttccactacactgaacgcacaaagaactccatcacgttcgcctggaaaccaccacgtaat
gatggcggcagccctatcattggttactttgttgagaaaaagaggcaggaccagcaggcc
tttgagccctgcaacactgagatctgtcccaacatgactatgactgtggagggcctggat
gatgcctggatgtacgagttcagaatcaagtgtgccaaccttattggagagagtgagcca
tccatcccactgactgtggttatccaagatgatgaagtgtctcctgagattcacatgctg
aagcagttcaaaggggacaccattactgtgaagaagggtgaatccatcgagatcccagct
gatgtcctgggactccccatccctaagattgagtggtctaaggatgacgtagtgatcgag
aagcctactgagactctactgatggagacaaatgtgactggcagaatgaattgcaagacc
atgctgtccatcccagcagccaacaggagggaccgtggcagttacactgtggctgcctcc
aacaacatgggttcagccacgcacacggtctatgtcatggtgcttgaccgaccaactcca
ccaaggaatgtgacagtaaccaatatcagaggtgagtcctgctacctcaactggcacgca
ccacttgataatggcggaagtgaactgaccaactacatcattgagaagaaggaagtggta
acagaggtgcctgaggtggaagagggacaggaagctccacctgaaccgcagtgggaggag
gttacaaatagtataattgagagaaaatatgaggtctggaacctggaagacaaaaagacc
taccttttccgggtacgggctgagaaccgctacggtaaatctgatccctgcacaactgag
gaagttcaaattatagaccccttcggccttcctggccctccagagaaaccaacaattgca
gagtactgcaagacctccatgactctaacctgggaacctcccagagataatggaggctcc
acgattattggttactggctggaaaaaagagagaaaggtactgcttactgggctaaagtc
aataagatgcccatcacaaagaggggcatgaaaggctgggagtaccaggtgacacgtctg
tttgaaggaacagagtacgagtttagggtcgcagcctgtaattcagcaggaaccggacct
ttcagtggaccatctgactctgcctttgctgttgaccctctcactcctccaagcatgcct
gctgctcccgaggtggccgataagacaaaacacaatgtcacactctcctggaaaccacca
gagagtgatggtggcagtcccatcaagggctacattatccagatacaggatgaggggaca
tcagagtgggtgagagtaaatgatcctgaaaccctgcaccccactactgagtttacagtg
ccaagcctccgcgagctgaagcgctaccggttcaggatcattgctgtcaatgacattgga
gagtctgatcccagcccccgcactagtgaagttcttattgaggatgtccaacttccacct
tcaatcacacttgatgtgatggcagatgacctggtttccatccgtgctggagatcccatt
agaatccccaccaccatcaaaggccggcccactcctaaggtaacctgggactttgacggc
aaagccaagtcgcacaagaaaaacaaactccacacactgcctgtggactctgaggtggag
tccacagacaccacttctgttgtgactatacctgtcagtctgaggactcactctggacgt
tacaccatcacagccaagaacaagtctggacagaaacacctcaacatcagggtcattgtc
ctcgatgttcccggacctccaaaggacttaaagattactgacatcacccgatcaaccatg
aggctgatctggaagctccccaatacagatggaggagagcgaatcaagagttactttatt
gagaagaaatctgtgaccgacaaggcctggaccaaggttaatgtagcctgtgctagccag
gcctacgtggtgccaggactgctagagggtcaggactacctgttcagagtgcgagcagag
aaccgattgggattcggcccgttcactgtcaccactgaacctgtccgggccagagacccc
atctacccacctgacccccccaccaagctgaaggttaacctggtgacaaagaacactgtc
accttgagctgggaggctcccaaaaataatggtggctctcctgtgaagcattacatcatt
gaacgattgagctgggacaccaccggcaaggagaaagagacctggaaacagtgcaacaag
agagatgtggaagagctcaccttcgtggtggaggatctcaaagagggaggagaatatgag
ttcagagtaaaagctgtaaatgctgctggacccagccgaccctctgccaccattggaccc
atggtcatcaaggatcagacatgtccgcccactattgaactacgtgaggctatggaggga
gaggagggctgtgacatcagcattgtcgcaaaagttagcggctgtccgttccccagcctc
gtttggcacaaagccagtctggacaaacctgaggagaagtctgccattcagtatgaccaa
cacatcaacaaactagtaacccaggataagtgcacccttctaatacagcaagccagcagg
catgacagctcactctacagcctgaccgccactaatagtctgggcactgtttgcaagggc
atcaagctctcagtgtttgggcctcctggtcccccagtcggaccagtcaagttcacggag
gtgtttgcagaaagaataggcctcgcctggaaccctcccatcgatgacggtggatctaag
atcaccaactacgtggttgagaagcgtgaggagaacaggaaatcgtgggtccatgtctcc
aatgatcccaaagagtgtacctatgtggtaacccggctgaccgagaaccatgagtatgag
ttcagagtcatggctcaaaacaagtttggagtaggcccaccactggtcagtgatccagag
aaggccagaaatctcttcactgtccccggtcagtgtgagaagcccactgtgaccgaagtc
tgtctggagtcaatgactgtcaactgggaagaacccaagtacgatggcgggtcccccgtc
actggctacatcatcgagaagaaggagaccactgccaagcgctggatccgtgtcaaccgt
gagcccattagggcactgccactgggcaacaactgggatgtcactgggctactggaaggg
gccctataccagttcagggtcattgctgtcaatgctgctggctgtggactgcccagtata
ccttctgaccccatactctgcagagaccccatcaagcctcctggaccgcccactccaaag
gtaacagactggacaaagtctacagttgagctcgagtggataccgcctctggtggacgga
gggtcaaaagtcacaggctacattgtggagttcaaggaggtgaacaaggaggaagaggag
aagaaagctcagaggaggctactcctgagtgtagctgaagaggagaaggaaacagaaact
gaagaggcctgggagaaggcaaaggacactgagatcagaggaactaaatttgtggtggct
ggccttaaggaaggtggtctgtaccgcttcagagtccgagctgtgaatgctgctggagta
ggagaccctggattagtgtctgagctaattgaggtcaaagacagaacaattcctcctgag
atggatcttgacgcctcagtgaaggagaaaatcgtagtccatgccggtggcaccatccgc
attatcgcctacgtgtccggcaaacctgccccacagatcacttggtgccgggatgacagt
gaggtgcccaaagaggccgtggtggagacgacaggcatctctaattcactggtcattaag
aactgcagacgccaacaccagggcatttatacactaagtgcaaagaacgagggcggagag
aggaagaaggcggtcattgttgaggtcctggacgttcctggaccagttggtcttcccttc
gctggagagaacctgaccaatgactcctgcaagctgacctggtactcccctgaggatgat
ggcggctcagccattaccaactatattattgagaagagagagtcagaccgcatgggttgg
acctctgtatcttacacagtgacaagaaacaatgctgtagtacaaggactcatcgatggc
aagggctacttcttcaggattgcagctgagaacatcataggcatgggacctttcgtcgag
accgacaagatggttctcatcaaagatcccatctctgtcccagagcgtcctgaggatcta
atcatcacagctattaccaaagactccatctccgtcacctggagaccacccaaatatgat
ggtggtgcagatgtgaccagctatgtccttgagtcccgaatgataggccatgacagcttt
gtgagagtaggcggagaggacaagctgatggacagacggttcacactaactgggctgaag
gaaggctcaagccatgagttcagagtctcagctgtcaaccaggtgggacaaggcaaacca
tcttttgccaccaaacctgtgcagtgcaaggatgaacttgagccaccgactctggacctg
gacttcagggaaaagctcatggtaaaggtgggagacacctgcatgctgtcgggacgctac
agtggcaaaccggcccctgctatcacctgggcaaagaatgatgaggacctgaaggcagat
gaggaaatcagcctccacagcaccacccaccacctcagcctcaacatcagcaaggccaag
agagaacacagcggccgctattgtgtcagcgtggagaatgctgctggcactcgctcggga
atctgcaccatcactgtggtcgaccgtcctcagccaccagagggacccgtagagttcaac
gaagtctacaggaattacatggtaatcacctggaagccgcctctggatgacggaggctgt
gctgtctccaactacatcattgagaagagagataccaacagagacctatggatgcctgtc
acctcatcctgtaccagaaccacctgcagagtgccaaagctaatcgagggccgggagtac
atcattcgtataatggctcaaaacatctatggcatcagtgaccctcttctgtctacagag
actaaagctagagacattttcaagacaccagatgctcccaagcagcctctggtgaaggaa
gtttaccatgactctgccctaatcagctgggagccacctgctgatggagggaaaccaatc
acaggctacattgtggagaggaaggagaccatggccaacaggtgggttcgctgcaacaca
gaaagaatccatcctaaggtggagtattgggtgaccgacctcctgaaaggctgcgagtat
gagttcagggtcagtgctgagaatgaagtgggagctggagacccaagcccaccatctaaa
ccggtctttgccaaagatcccattgtgaaacctagtccgccagtgaatctaaaggctatc
gactttaccaaagagtcagttaccctgtcatgggagccacccaccgacactggcagagga
aaaatctttggatacttgctggagttccaggcagctggaaaggaggaatggctcaaggtg
aaccagactccagactcctgcaaagaaaccaagtttaaggttatcaacttggaagatggt
gttttgtaccgcttcagagtcatggctgtcaacgctgctggggagtccaacccagccaac
cttactgagccgattagagtacaggacagacttgagcctccagagttgattctggatgcc
ggaatgacccgagaaattaaagccatggctggcactcatattgctctgatagccggcatc
aaaggtgtcccatttcccactgtcacctggaagaagaatgacgcagaagttccccctcgg
gcagatatcgaaaccaaccagacaggcaccaagctggagatgaggttctgccatcgtggt
gactgtggagattacaccctaactgtggagaatccagcaggaaccaagactgtcacctgc
actgtgctagttcttgacaaacctggtcctgtacagcacctccgtgtgtctgatgtcagg
agtgactctgcctacctgtcctggaaagatccagaggataatggtggtactcgcatcact
aactttgtggtagagaagaaagacacagcttccactcagtgggtccctgtctgctctaca
tcaaagaaacgcagtatgatgttgaagcacctgatggagggcacgtcctactcgtttaga
gttgccactgaaaaccagttcggccgcagcgaatatgtcgagacaccaaaggccatcaag
gcaatgaacccactcttccctcctggtcctcccaaagacctgcatcatgttgatgtggac
aagactgaggtatggttagcatggaactggcctgatcgcaatggaggaagtgaaatcata
ggctttctggttgagtaccaggaagagggagagaaagagtggtatgaatggaaaactgtc
agcatccctgagagtcatgtgactggtctggaggaaggaaaaacctaccgcttcagagtg
agggctgagaatgccattggcctcagcagacctgataccacagtgcctatcctctgccag
gagaaactagtgcccccaattgttgaagttgatgttaaactcactgaaggcatcattgtg
aaggccgggactaccatcagactgccagctataatgagaggaatccctgtcccaactgcc
aagtggtccatcgaaggagaggagatcaccagccagggcaacattaagattgacactgat
aatttctccactattctcagcattaatgagtgcaccagaaaccacactggaacctacctg
ctcactgtgtccaacccagcaggaaccaagacggtggccttaaatgtcactgtactcgat
gttccagctgctccgattggacctgtcaacatattggaggtcatgccagattccatgaca
attgaatggcgtcctcctaaagatgatggtgggagccctataaccaattacattgtggag
aaaagagagtccaacaaagagacatggggaggtgtgagttctggtagtcttgcaacgcag
ctccggatcgctcgccttcagaaaggagtagaatatgtagtccgcattcgtgctgagaac
aagatgggcattggtgctcctctggagagcaagcccactgttgctgagcactcattcatg
ccccctagtgcacctggtaagccacaatcctatgatacctcagaggatgctgttacactt
ggctggactatgcccctaactgatggtggcagtcagatcactggctacatcattgagcgc
agacacaagggaggaaagtggatccgtgtcaacaagacaccttgcaaggacctgaggtac
cgagtcctgggcctctacgagggcagcgagtatgagttcagagtgtttgctgaaaatatt
gctggatttagtggcccctccccagtctccgacccctgcaagccctgcaggcccatcact
gtcccgagtccccctgtcaatcctaaagttaaagattacagcagggccactgctgacctg
gtgtggaccaaacctaccaaagatggaggcagcccaatccttggttacactgtggagatg
aagaaagctagcgctgaagaatggaaaaaagtcaacctggatgacttgatcaagcagtgt
gcctacagggtgaagggtctggaagagggtgtgacctatagattcagagtctttgcttca
aacatgattggagacggggagccaagagaaatcccagaatcagtcactgctcaggatatt
cttatacctccagagattgagatggaggccacttgtcgagattgtgttactgtgcgtgtt
ggacacaacatcaacatcattggttacatcaaggctcgccctgatcctgaagttttttgg
tcaaaagaagagactattctagagaacagcaaacgtgttaccatcctgcagaatcttcct
ttagtccacctaaagatcaaggaagctacaaggaatgaccatggcaaatatattctgaaa
gcttcaaatgaaggtggtgaggcttcccgcacaatcacagttaatgttctagaccgaccc
agccactgccagaatctgaatgtgacctatgtcactaagggctcatgcatgatcaactgg
gagagccctaaggacaatggtggatccgagatcaccaactacattgtggagtgcagagag
cctagtattagcatgtggtctatgatctcttcccactgcactaatcgtaagatcaaggca
aagctgatggaaggccatgagtacctgttccgtgtctgtgctgagaacaaaataggacca
ggaccctccgtggagatcaaaactcctacattggccatggaccctattgacaagcccggc
gagcctgagaacttcagagcaattgacattggtaagaactatgtcaatttgaggtggcgg
aagcctgactatgatggtggaagcccccatctctcctacaacctggagtgtaaaactaaa
gatgcggaggagtgggaaaaactcaacaccactactctcacagacaccttctttttggct
gataaatgtgtggaaaatcagacgtacaccttcagagtgcagactgtcagtgaaggaggt
gagagtgcctgggtaaaacttgcagatattctggtgagggaggagatccagaagcctgtc
attgacctgaagttggctggaacactgacagtaaaagctggagagtcagtcaggatggag
gctgctctgagaggaaagccccagcctgaggttaaatggatgaaagataaggctactgga
gacaatcccagaataagctatgaaactggcccagactactcaaaatttctgatgactaag
tccaagcgtagtgacacaggaaaatacattatcactgccaccaactcgggtgggactttc
acagcatatgccaatgttaatgtcctggacgttcccggcccagtgagagacctgaggatt
actggcattggagctgacaagtgcagagtggtttgggatgctccagaggatgatggaggt
tgtgaggtggacagctacattctagagaaatgtgaaaccaggaggatggtttggtccaca
tattcagcctctgtggtcacaccatactgcaacgtcactcgtttggtggagggcaatgaa
tacatattcagagtgcgggcagaaaacaagatgggaactggccctgccatggacagtaag
cctataactgtcaagactcagttcaacaaacctggaccccctgatgcccctgaagtcacc
aaggtgagcaaagatgagatgactgtggtctgggctcctcctgagaatgatggaggaaag
tcaatcactggttacatccttgaaaggaaggagaagagggcagtgcgctgggtgccctgc
actaagagcccaatctctgagagacgcatgaaagtaaccaacctgattccaaaccatgag
taccagttcagagtgagagctgagaatgatgtcggtctgggagatcccagtaaaccctgc
agaccagttgcagccaaagatcctattgagccacctggtccccctgcagccctgaaggtg
gccgacagcacaaaaacctctatcactctgtcctggtctaaacctgtctatgacggtggc
gcccccattattggctatagcttggacatgaggctgaaaagtgaggcggaccctgagaat
cccacagtgggctggaagagaattgatactcatggaccactggtgctcacagaatttact
attggccagcttgatgaaaagcaggagtatgagttcaaggtgtcagcccaaaaccaggtg
ggctggggacgccatgcttatttgaaggaggcagtgtctcccaaggagatcctggaggct
ccagaaattgagctggatgccagtctgaggaaaggcctttctgtgagggctggttgtcct
ataaggcttttcgccgtgatcagaggaaggcctgcccccaaggttacgtggaagcggttg
ggtgtggacaatgtaatccgccgaggtcacgtggaccaggttgacaccatgtccttcctt
gttatccctgagagcaccagagaggattctggaaaatattcactcactctgtccaactca
gctggagagaaagcaatatttgtccgtgtcaaagtccttgacacacctggtccggttggc
agcctggatgccactgacatcaccaaaacaacagctcaactctcctggttgccaccagag
aatgacggaggcagccccatcctcaattacgttgtggagaaacgagaggttgataggaag
acctggaccaagtgcacagaggacctgaagaagactagctttaaggtcaccaaccttaca
cctggcattgagtattacttcagagtcatggcctgcaacaagtatggcattggagttcct
caggactcacccaggtcctacttggctgttgacccaatcagtgagccagaccctccaaag
aagatggacgtgttagagatcaccaagaatagtgctacactgggctggctaaaaccactc
agggatggaggtgccaaaatcaatggttatgtggtggattaccaggaggagggtgcacct
gaggacaaatggacaccatattctgtggtcaaagacctgactatcgtggtagttggtctg
aaagaaggaaagaagtataagttcagagtggctgctaggaactcagtgggagtcagtttg
gctcgagaggctgagggaatgtttgaagttaaggagcagctcatggctccgaagataatc
atgcctgacattgtgacagtcagagctggatccaagatgacgattgaggctattgtggca
ggtaaacctgctcctgtctgcaagtggaagcagggcaatgaggatgtgctaacctctgat
cgcctgtccattgtaaagacgctgacaactacctcacttattataaagaatgtcacaaga
aaggatagtggttactacagcctgtcagctgagaacagtactgccaagattaatcagatc
ctcaaagtcatcgtcatggacatccctggaccccctgaagctcctttggagatcactgaa
ctggacatggatgcgtgcacactgctctggaactcgccacaggaggatggtggtagcaac
atcaccaactacattgtagagaagtgtgatgttagccagggtgattggatcaccgtttct
acatcttgcacaaagacgagcttcagaatgaccaaactgacacctggcaaagagtacagc
ttccgtgttcgtgctgaaaacaggtttggcgtctctgggcctacctactctgagaagatg
attgccagatatccatttgatcctccgagtgaacccagaaacctgcagataaacaagatc
aacaaggatttcgtcatcctatcatgggagcgtcccagctctgatggtgggagccccatc
agtggatattgcattgaaaagaaggagaggaatagccttctgtgggtgaaggctaatgag
actctggtcaaagccactcagtacacctgcacaggcctgatcgatggcctggagtacacc
ttcagggtgtcagcacaaaaccaggccggacagggcaaaccttgtaaacagacagacttc
atcactgccaggactgctgtcgacccaccaggaaaacccgagcccatggatgtgaccaag
agcactgtatcattagtgtggggccgtccaaagcatgacggtggcagcaagttgattggc
tactacgtggaatatacaaagcttccagaagagaagtggactcgctgcaatgccaactgc
atgaacatccagacagagaactatgtggtgactaacctacaggagggtcaacaataccag
tttagagtcatcgccaagaccgcaattaacagcagccttccatctgagctgtctgaccct
attcctgtcatcgcagagaatgttgctcctcgtgtggaattaggtgttaacatgaagaac
ctgattgtggtgaaagctggagaaaatgtcttcctggatgctgaggtctttggcaaacca
cttcccaaagtgagctggaagaaggatggagtacctctggtccttgctgagggaatgaag
atgtcccaaaagaaacatcttcatctgctggagctatactctgtcaccaggaaagagact
ggggactacactatcacagctgaaaatgtcaatggcaccaagtacgccaccataaaggtc
aaagtactcgacaaaccaggccctccagcctcagtgaaaatttctaaggtgtttgctgac
cgtgttaagctgcgatgggtgccaccacttgcagatggcggttctgaaatcactaactac
atcattgagaagcgtgagactagcagggccaactgggcattggtcacctcaaacatccat
ggacacatcactgactgttcagtggagaaacttattgaaggacacgaatatcagttccga
gtcagtgctgagaaccagtatggtgtgggagatcccattatgactgatgccgtcacggtc
aagaatccgtatgatgttcctggtccatgtgagccacctgtcatcaccaacatcacacag
aactccatgacagtcagctggaaggccccagccaatgatggcaagtctcccatccttggc
tacatggtggagaaacgtgaggccactgagctgagctgggctaaggttaaccgccgacca
gtcattgataggaccatcaaggccattcaactgactgagggctctgagtatgagttcaga
gtaattgctataaacaaggctggtcttgggaaacccagcgacgcttcaaatggtgccctg
gctgttgaccctgtctatcctcccgggccacctgccttccccaaggtggtggactctacc
aagacgtcagttagccttagctggaccaaaccagcatatgatggtggctgtgagatcatt
ggatacttggttgagtgcaagcgagttgatgcagagagctggacaagatgcaatgtgccg
aagaaactccaggccacgaaattcctgctgacaggcctgatggacaacactgagtaccag
ttcagagtcacggctgttaacaagattggctacagtgagcccagcgaggtgcctggaaac
tacatgcctaaggatattctaattgctcctgatgctgagcttgacgctgacctgagaaaa
gctttggttctgcgagctggagtaaccatgaggctctatgtaccactgagaggacgccca
gcaccgaaggtgacatggactaaagttgatgctaatttgaaggaaaggcaaggactactg
atcaagacatcggactgggacaccctactgatgattgaggatgttaacagatgtgattct
ggcaaatatgttctgtcactggagaacagcagcggctctaagagctacaccatcgtagta
aaggtccttgattctccgggcccacccttaaacctgactgtgaaggaaacctccagaacc
catgcctgcatcacctgggatgccccactgattgatggtggtagtccagttaagaactac
atcgtagagaaacgtttggctgagaggaaagcctggacctgtgtgtcagcagattgtcct
aagatttccttcaggatcaccaacctggaggcaggacaggcctactgcttcagagttcta
gctgaaaatgcatacggcattggagaaggctgtgagaccccaggcagcatcagggcctct
gagcaacctggtccagtgacagacttcaaagctcagaagactacaaagaactctatcacc
ctgtcctggaagaagcccatcaatgatggtgggagttttattactgcatacatcttggag
cagggtgaaggcgaggagaagtggaagcagatcctgaaaggcaagaatacctcacacact
attggagaactgacagaaggcaaggagtattctttcagggtcaaggcactcaacgagtct
ggagagggaccacccactgagctcactgctattgcaaaggaccaatttgtgctacccgac
tgcaacttaagtgatctgcacgatggctgctgtgtggttaaggagggcagcacaacacgc
attaacatccccatcactggagttccaaaccccactgctacctggaagaagggcgatatg
ggagtgggtgatactggccggatgtgtgttgaagcatctcagggcatcaccaccttactg
attagagactcccagagaggagatgctgacacctacactataaatgtcaggaacagtgct
ggctcaaaggactgcaagttccagctgaaggtggttggcaaacccggtatttgcactgga
cccattacgtttgatgagataactgccgatgccatcacactagagtggggaccacccaaa
gatgatggtggtgcagaggtgtctaattacattgtggagaagaggagaacaacagataac
aagtggactacagtggcttctgccatccagaagaccaccatgagagtgatcagactccat
gacgggatagaatacatctttagagtgtttgctgagaacaagtatggggttggagaacat
ctgaggtctgacccagtcgttgcccagcatcctttcaatgttcccggggcacctgctcca
ccagaaattgtgagcatcaggcatgaatcagccatcctgacttgggttgatccaaaggac
actggtggtgccccagttactggatatcacatagagtataaggaaaagaacagtctgatg
tggaaacgggcgagtaagactcctctgagagtaaaagaatgtagagtcactggactgaca
gaaggattagaatatgagttcagggtaatggccatgaacatggctggcctgggaaaggct
agcaaagtaactgaggccgtggttgctctggatcctattgatcctcctggcaagcctgaa
gtaatcagtgtcaccaggagcacagtcactctgatgtggacagctcccaaatatgacggt
ggctacaagcttactggttatatcatagagaaacttgaggccagtggtaaggcctggatg
aaagcaaatcatgtcaacattcagggctgtgcttttaccgtcactgacctgactgaagga
tcccagtatgaatttagagtcagagctaagaatgctgcaggtgccatcagtattccttca
gagcctactccgcttttgacctgcaaggatgaatatgagcccccaaccatcactattgac
ccagaaatgaaagatggtatagccatcagagcaggagacacaattgtaatctcagcttct
aaaattgtgggcaaacctccacctactgcagcgtggtccaagggaggacgtgagttgaag
acttctgacattgtcaccatcaccagtaccccaacctcctctactctggctattaagtac
gcaagtcggaagaacacaggggagtacactatcactgccagcaacccctttggcattaag
gaagaacatgttaaggtgaaggtcttagatgttcctggacctccaggcccagttgaagcc
agtaacatttcagccgaaaagtgtaccctgacctggcttccaccagaggaggatggaggc
tctactatcaaatcctacatccttgagaagagagaaaccagccgactacagtggaccaag
ctagctgaaaatgtcatggattgcagacacgtagtcagcaaactgattaaaggcaatgaa
tacattttcagagtgtctgctgtgaaccagtatggcacaggagattcaacccagtctgct
ccagtcaaaatggttgatagtttctcaccaccaggtccgccctcaaccccagagattgat
aatgttagtaggaatgctgtcaccatttcatggaagagaccagtacgagatgggggaagt
gacattaggggatactgtgttgagaggaaagagagaagaggactgagatgggtcagagcc
tgtaagcggactatccctgacctgcggtttaaggtgcaaggcctgagtgagggagtagag
tacgagtttagagtcactgctgagaacaaggctggatttggggagccaagtgaaccatcg
cgccctgtcatgacaaaagatattgtgtatccacccggtcccccatccaaccctagaatt
acagaaaccaccaaaacctcagccacattcacctggggccgaccccactatgatggtggt
cttgaagtagagggctacattgttgaatataaaaaggaaggacatgatgattgggagaca
gagacacagtacccactgaaagcttcagaatacgtgattggtaaactacaaaaaggaggc
aaataccacttcagggttagtgctgtaaactctgagggaataggcgagcctgcagaggtt
gagaaagtgactgaattggtggaccaggagatgttgccagactttgagctggatgctgaa
ctcagaagaactctggtagttagagttcgtgcttcaatccgtatgtttgttcctatcaag
ggtcgtcctgtccctgaagtcacatggagtaaagatgatgctaacctgaaaacacgtgca
catattgacaacacagagtcgtacactcttctggttattcctgactgcacaagatatgat
gctggaaaataccacctttctctagagaatgttgctggaaagaagactgggtttgttaat
gtgaaagttctggatacaccgggaccaccagtcaatctcaaacctagagagatcacgaag
aacagcatcaccctacagtgggaaattcccattattgacggtggttctaagattcgtaac
tacattattgagaaaagagcagccactaagaaggcctacacagtgcttagcaccacatgg
cagaagtgttccttcaagattccagacctcgaggagggagcttactactatttccgtgtc
tcagctgagaatgacctgggtgtgggtgagccagctgaaaccccagagccaatcagggta
tcccaggccccctctgccccagaaaatttgtatgtcaccgatgttacctctgatagtgcc
agccttgcatggaccaagcctttgcatgatggtggcagcttgatcactgggtatgtcatt
gaggctcaaaagaaggacactgatcagtgggtccatgtggccaccattaaggctctggat
tatactgttacagatctaattgagggtgctgaatataccttccgtataatggcagtcaat
gcatcaggcaggagtgatccccgtgagagcagaccagctgttatcaaagagcagacttct
gctccttcatttgacctgcgtggggtctaccagaaaacgatcattgctaaggcaggagat
cggttgaaggtggagattccagtgttgggcaaaccaaggcctgtggtttcatggaagaaa
ggagatacagtgctcaaggagacacaaagactcaacattgaaaccacaccaacatcaact
attctcaacatcaatgagataaaaaagaaagatggaggccagtattctatgactggtaaa
aacatgctgggggcaatgacagagacaatcacaatcctggttcatgacattcctggacct
ccaactggtcctattaagctggaagaaatttcatgtgattatgtgctgatgtcctgggac
ccaccagaaaatgatggaggggttcctattaacaactatattgttgagatgcgggagacc
actggtacttcatgggtagagctggcagctacagtcatccgcaccacatttaaggcagcc
agactcactacaggaactcagtatcagttccgcatcaaggcccagaacagatatgggatt
ggaccaagcattatctctgaaccagtggtagctgtctatccatttgatgtaccaagccag
cctggcactcccgtggtcacctctttcaacaaggatgctatgacccttagttggaatgag
ccatcctctgatggaggtagtgccattctgggctatcatgtggaaaggaaagagaaaaac
agtattctgtggcagaggatcagcaaagcccttgttgttggaaatctgtttaaatcaacg
ggccttattgatggaattgcatatgaacaccgtgttattgctgaaaatatggctggtctc
agcaaagccagcaaaccctctgagcccatgtatgctttggacccagttgatccaccaggc
aggccagtagcactaaatattactaggcatgaagtgaccttgtcatggaccaagccagag
ggagatggaggattttctattactggatacaccgtagagaggagggagatgcccaatgga
cgttggctcaaagcaaacttcaacaacattctggaaactatctacacagtcagtggtcta
actgaagatgcaacctatgaattccgtgtgtttgctaggaactcagctggtgctgttagt
gctccatcccagtcatctgaagcaatcttgtgcagagatgacattgaagagccccggctt
gatgtagatgcatcatatagcagcactgttgttgtcatggcaggagaggtattcaagctg
gaagccagtgtaactggaaggccaatcccatctctggtatggaccaaagaaggaaaggag
cttgaggatacagccaaaattgagataaaaacatccgagttccacacaactttaacaaac
aaagattcgctcaggagggatggtggtgctttcactttgattgccagcaatcctggtggc
tttgctaagttcatatacaatgtcaaggtgttagatagaccaggacctcccaactccctc
actgtaacagatgtcactgctgagaaatgtgtccttaattggctccatccaacacatgat
ggtggtgccaagattgagtactttatcattcagagacgagagaccagcaggttggcttgg
acaaatgtggccacagaccttcaagctaataggttcaaggtcaccaagcttctaaagggc
aatgaatacattttcagagttatggctgttaacaagtatggtgtgggtgaacctgtggag
tcggaacctgtcatctgtgccaacccctatgtacccagtgacccaccacagcaacctgaa
gtcaccataatcaccaaggactctatggttgtctgctgggatcgccctgaacatgatggt
ggcagtagaataaacacatacataattgaaagacgggacaaaactggcctgcgctgggtg
aagtgcaacaagaggactgtaactgacttgcgattcaaagtctcaggcctcacaccaggg
catgaatatgaattcagagttcttgctgagaataatgctgggctaagtcagcccagtcct
tccagtccattctacaaagccattgacaccatcttccaacctggacccccagggaacccc
agagtgctggacacaaccaagtcttctatcacacttgcatggaacaagcctgtctatgat
ggtggttcagaaatcactggttacatagtggagacctgcctgcctgaggaggatgaatgg
acaattcacactcccaagaatggttggactgccacttctttcaccatcaccaatttgagg
gaaaaccaagagtataaaatcaatatttctgcaactaattgtgaaggagtgggagagcct
gcagctgttcctggaacacccaagtctgaagacagactagttcctccagaaattgaactt
ggagcagaactacgtaaggtggtctgcatcagagcctgcagcacactcagactttttgtc
cctatcaagggaagaccagcacctgaaataaaatggtctagagagcatggggaatctcta
gataaagctaacattgaaatcacctcatcattcaccactcttcaggtagagaatgttgac
agatttgatgggggtaaatacattgtgactgtagagaatgcctcaggaagtaagacagcc
tttgttaatgtcagagtgctagacagtcctggagcacctcagaatctgattgtcagggag
gtcactagagattcagtttctcttgcttgggatgctcctgtcattgatggtggttccaga
gtccgcaattacatcgtggagaagcgtgaatcaaccagaaaggcttattcaactgtgtgt
gccagctgccataagtcaagttggaaagttggagacctagaggagggaaagatgtacttc
tttagaattttggctgagaatgaatatggcattggcctcccagtagagactcttgaacca
attaaagcatcagagaggcctcttcccccaggcaaagtgtctctccgtgaagttaccagc
aaaagtgtcacattaagttgggaaaagcctgaccatgacggtggaagcagaatcactggc
tatatagttgagatgcagggaaaaggcagtgagaagtggacccaggttatggttgtaaaa
agcaatgaagctcatgttactggccttacacagggagaggagtatacattccgtatttca
tccattaatgaaaagggagtcagtgacccccgccctctcaatgtgcctgtggttgccaag
gatctggtcatctcaccaaccttcaaagttcttttcagcacatttagtgtgctagcaggg
gatgatctgaaaatagatgtaccatatgctgcccatcccaaggctacagcaacttggctc
aaagatggtgttgctctcaaagagacgacaagagtgaatgcagatgccacagacaaaaat
cttctcctggttattaaggaggcttgcagagatgatgtgggaacatatactgtcaaactt
actaacacagctggagaggcatctacagatatcagtgttattgttttagataagcctggc
cctccaactggcccaattaagctagatgaggtcactgctgatagcgtgatcctgtcctgg
gatccacctcagtatgatggcggttgtgccatcaataattacatcgttgagaagagagac
acatctaccactaactggcagattgtgtcagctacagtagccagaaccactatcaaggca
gcacgtctgaaaactggatctgagtaccaattcaggattgctgcagagaacagatatggc
aaatcttcagccctgttatctgatactattgttgctcagtatccttttgaggttcctagt
tcaccacgttctgttaccgttcagtcaaccaccaaggaaagtatggtggttgtatgggaa
aaacccagcaatgatggtggaagcaagattttgggataccatttagagctaaaagagaga
aacaatatattgtgggtgaaacagaacaaacaacttgtcccagaaactagattcaaggtt
attggcctggaggagggtattgaatatgagttcagagtttatgctgagaacattgttggc
ctcagcaaagccagcaaagtgagtgaaatacaagttgcccgagatccttgtgacagacca
ggaaaaccagaagctgtcattgtaacacggaaccaagtgacactaagatggacaaaaccc
caatatgatggtggaatcaagatcacaggttatgttattgagaagaaggagggagctggt
cgctggatgaaggccagtttcactaacatcactgaaacagaatttgttgtcacaggactt
attgagaatcagacttatgaattccgtgtcattgccaaaaatgcagcaggtgtttttagc
cagccatctgattctactggagccatcactgccaaggatgaggtggatccacccaaaatt
gacttggaagttaaatactcccaaactgtggtagttaatgctggagagacatttaaactt
gaggctgctgtttacggtaaacctgtacccacaattcattggctgaaagagggccaggag
atcaccgaagcagctcgcttagagcttaagaacacagattttacagcttgtcttgttgtt
aaagaagccatccgtgttgatggaggtcagtacatacttctagtaaagaatgttggagga
gagaaatctgttaacattaatgttaaggttttagatagacctggtgcacccgaaggccct
atatccatttatggtgtcactaatgaaaaatgctcaatttcctggaaacctcccttgcaa
gacggaggaagtgatgtttcccattatattgttgagaggagggaaaccagcagattggtt
tggactgtagttgaaccaaaagttcagacactgaacttgaagatcaccaaattacttcct
ggtaatgaatatattttcagagtgattcctgttaacaaatatggagttggagagccactg
gaatctgagccaatggttgccaggaatccatttgtcactcccaacccaccaacaaatgtg
gaagtttccacaatcaccaaagactctatggtggtgacctgggagagaccaactaatgat
ggtggcagcccaatccagggatacattgttgagaaacgtgacaaggatggtgtgcgatgg
actagatgcaacaagcgcaatattagtgagctgcgctttagagttaccgggcttcttgaa
aaccatagctatgaattcagagttgctgctgagaatgctgcaggtgttggcatgcctagt
gcaccaacagtgtactacaaagcactggatcctgtcttcaaaccaggcccaccaaacaac
cccaaggtggtagacacatctagatccactgtttctctaacatggggcaaacccatctat
gacggtggctgcgaggttcagtcttacattgtagaggcatgtaatggtgcatctgatgag
tggtttatgtgtactccaccaactggaatcatggacacaaaatatactgtgaaaaaactt
ctggaaaagcatgagtaccaatttagagtgtgtgcaatcaacaaggttggtgttggtgag
catgctgatgttcctggaaaaattcttttggaggagaaacttgaagcacctgatcttgat
cttgatgcagatatgagaaagatgatcaacatcagagcagcaagtacgctcagattgttt
gttcctgtaaggggtcgtccagctccagaggtgaaatggggcaaggctgatggtgagatt
aaggagactgctcagattgacaatacaggcaactatgcatcacttgtcattgagaatgtt
gacagatttgatagtggcaagtacaccctgactgctgagaatgctagtggagtaaaatca
gtcttcataagtgtcagagtgctggactcccctagtccaccaactaacttcgtggtgaaa
gagattaccaagaattctgtcactctcacatgggagcctccacatctggatggtggctca
aagattaagcactatattgttgaaaagcgtgagagcaccaggaaagtgtactctcccatc
acgacatgcaacaagatgtcatggaaagttgaacctcttccagagggtggaatctttttc
tttagagtattggctgagaatgaatatggtgtgggtctccctgctaaaactacagaacca
gttaagatatctgagaaacctcagccacctggcaaggtcagtgttgttgatgttactcac
agcactgtaactttaacttgggaaaagcctctgcatgacggtggtagtagaatcacccac
tatgaagttgaactagctcccaaggacagtgaagcttggtctatatgtgctagtgtgaaa
gcactggaaacattagtgacaaaccttctcaagggagaggagtaccagttcagagttgtt
gctgtaaatgataagggcaaaagtgacccacgacagttggctcattctgttgtagcaaag
gaccttgttattgaacctgctgttagacccaaggcaagttcttacagtgtccaggtgggg
tatgacctcaagttagaggtcccggtcgctggtcaccctaaaccaattatcacctggacc
aaagatggcgtagcccttaagcagactaccagagtcaatgtcaccgactcagcacaaact
accactcttaccataaaggatgctaccagagaagatggaggtatgtacactatcggtgtc
tccaatgaccttggttcaaaggatgccactgtagaggtgatcaccttggacaaaccaggc
ccacccacaggccctgtaaagttggaggatatcagtgctgagagcatcaccctcagctgg
gaacctcctacatacacaggtggttgtccaatctcaaactatgtggtggagaagaaagac
acaaccacaacaaactggtcggttgtgtctgccactgtggctagaaccactctaaaagtc
agcaatctgaagacaggcactgagtaccagttcagaatctatgctgaaaatagatatgga
aagagctatgcaattgattcacagcctgttgtggcacagtatccattccaggagccagga
ccaccaggaacaccatttgtttcttcatacactaaagactacatggtagttgagtggcat
aaacccccaagtgatggtggcagtgccatcttgggctaccatctggaaagaaaagaaagg
aacagtatcctctggacaaagataaacaaaatgctcatccaagattgtagattcaaatct
actccactcgaggaaggcattgagtatgagtatagagtctatgcagagaacattgttggc
attggtgaatgtagcaaagtgtctgaggtttatgttgcccgtgatccatgtgatcctcct
agccgtcctgaggctgtgattgtgaccaggcactcagtgaaactcaagtggaaccccccg
gcgtacaatggtgggagtttagttacaggttatctagtagagaaacgtgatcttcctgaa
ggaaaatggatgaaggctagcttcacaaacatcattgaacacgaattcacagttactggc
ctcacagaagatagcaaatatgacttcagagtaattgcaaagaatgctgcaggtgccgtt
agcaagccctctgagagcacaggatccataactgctaaggatgaagttgtaccacctaag
agtgagacagatcctatgtacaaccagaccattgttataaatgcaggagagacattcaat
cttgaggccagtgtggaaggaaagcctattccaactgctcagtggttcaaggggaatctt
gaagttgaaaactcagcaagagcggagatcagaaacacagattttaaagctttgcttgtt
gtaaaggatgctatcagagttgatggtggacagtatactctggttctcacaaatgtggca
ggaagtaagactatccccttcagtgtgaaggttctggacagaccagggccttcagaagga
cctcttactatcagcaatgttactgaggaaaaatgctcactgtcgtggctgccacccagg
catgacggaggcgccagcatttctcactacatcattcagaaaagagaaactagccgcttg
gcatggactgtggtctgcagtgattgtaaagctaccatgtttaaagttacaaaactactg
aagggaaatgagtacatcttcagagtcatggctgtcaacaaatatggcacaggtgagccg
cttgaatcagcaccagttatcatgagaaatccatttgttccacctggagcacctcaggat
cttgagatcacaaatatcaccagggattctatgactgtatgttggaaccgtcctgagaca
tcaggaggcagtgacattgttggctacattgttgagaagagagacagagcaggagtgagg
tggaccaagtgcaacaaacgcagagtgacagacttgcgtttcagagtaacaggactgact
gaggaccatgaatatgaattcaggatatctgctgagaatgcagctggagtgggccagcca
agtccatcgacaacctatcttaaagcatgtgaccccaccttcgagccaggctgtcccacc
aatgtccatgtggtagacactactagagactccatttgtctggcttggcacagacctatc
tatgatggtggctgtgagattcaaggctacgctgtggaaataaccaaggctgatgaggag
gaatgggccatatgcaccccaccttgtggagtcaatgctaccaagtttactatcaaaaag
ttgattgaacaccaagaatacaaagtccgcatttgtgccatcaacaaggtgggtgttggt
gagcccactgagattcagggagtcgtcaaacctatggataaaattgaccctccagaagtg
attctggattcagagctcaggaagggaatagttgtccgtgcaggaggctcgatgagagtc
tgcattccattcaaaggccgtcctactcctgagataaactgggccaaagaggatggagag
ttacccagtaaagttcaggttgagactggtgaagattacacacagctctcaattgaaatc
tgtgacaaatatgatgctggaaagtacgtgctcaatttagaaaacagtgctggcaccaaa
tcagcttttgtttccgttaaggtgctagacactccaggggctcctttaaacctaacagta
acagacatcaagagggaaagtgtgactctgacctgggagcctcctcttattgatggtggt
gcaagaatcaagaattaccttgttgaaaagagggagtccacaaggaaggtttactctaat
gtggacaacaagtgcacaaagacaagctatcgtataactggcctgacagagggaactata
tattatttcagagtcttagcagagaatgagtttggtgtgggacagccagctgagacagaa
gaatcagtaaaaacatctgagccccccctgcctgtgggtaaggtcacattgaccgaagtg
acaaaaacaactgcttcactctcctgggagaagccagatcatgatggaggtagcagaata
attggttactacattgagatgcagcctgttggctcagaggaatgggtggtagctgccaca
tgcaaaacttgtgaaggcactgtcacaggcctcagtgcaggacatgagtacctatttcga
atcttagccttcaatgagaagggcaagagtgaccctagacctttggctgcgccagtcact
gctaaagatataaccattgaacccaaattcaagattcaatttaacacttatagtttacag
cacggtgaggatttgaagattgagattccagtgattggacgacctgttcccaaggttgaa
tggaagaaggatggacaagctcttaaagagacaacaagaattaatgtttccagcacattg
tcatgcactaagctgtacatcaaagatgcaaataaggacgactctggcaaatacactgtc
acagccaccagtagcattggaacagctacagaggagattactgttattattcttgataag
cctgggccacccacgggccctgtaaagatagaagaggtgagctctaattatgtcactctc
tcttgggagccaccagagtataccggaggctgtcccatcaataattacatcgtggagaag
agagatactaccaccacagcatggcagattgtttctgctactattgccaggacaaccatc
aaagtcaccaagttgaagactggtgttgaatatcaattcagagtgtcagctgaaaataga
tacgggaagagttctgcaattgtctctcctgctgttattgctcagtatccatttagtgag
cctgtggccccaggaacaccagtcatttcttctgtaaccaaggatagcatggtcgttgag
tggaaacctcctaccaacaatgggggcagtccaattcttggctatcaccttgagagaaaa
gaaaagaatagcctcttgtggactaaattaaacaagcttctaatcccagacacacgtttc
agaactacagaacttgaagaaggtattgagtatgaattcagggtttatgctgaaaacgtt
gctggtctcagcccagctagcaagctgtctgagagcacagtagcaagggacccttgtgac
tcaccaggaactcctgagcctattgaaatcaccagaaaccatgtgacactccagtggacc
aagccccagtatgatggagggagtgcaattactggctatgtgattgagagaaggaagcac
ccagacacccgctggatgaaggccagcttcactaacatcattgatacacaatttacactt
actggtctgactgaagactgtgtgtatgagttcagggtcattgccagaaatggtgctggg
attttgagccaaccctctcagagcacaggggaaattactgccaaagatgaaattgaggct
ccagcagccaccatggattcgaaattcaaggatatgactattgttcacgcaggtgagaca
tttgtcattgatgctgactatactggaaaacctttgcctgaggtcatttggttaaaggat
ggaaaagagattgacaaagccacaccaagaatggaaatcaagactacccttacacgtacc
atcctgacagtcaaggattgcatcagagtggatggtggccactttgtcctcaagcttatt
aatgtgggaggagtcaagatgatcccagttaatgtcaaagttctggatagacctgggcct
ccagatggacctctagaagtcaaaggggtcacagctgagaaatgttatctgcattggaat
catccctcacatgacggaggagctggcatctctcactatatcattgagaagagagagact
agtcgtttgtcatggactatggttgagcccaagattcaggcaatcagccacaaaatcaca
aaactattgcctggcaatgaatatatctttcgagttactgctgtaaataaatatggtgtt
ggcgagcctttagaatcagaagctgttgttgctcgtaaccctttcaccactcccagtgcc
ccctcaaaccttgaggtcggtgccatcactagggactccatggtgctttcctgggagagg
cccaatgataatggaggtgcagagattgagggatatgtccttgaaaaacgtgataaagat
ggtatcagatggagtaaatgcaacaagaagaggctgaatgacctgcgattcagatgcact
ggtctcacagagggccactcatatgaattcagggtttcggctgaaaatgctgctggtgta
ggaaagcctagtgcaccaactccgtacatcaaggcctgtgatgccacttatccacctgga
cccccaaataatccaaaggtcactgaccattcaagtaccacagtttccctttcatggtcc
aggcctatatatgatggtggtgcacagatcactgggtatattattgaaatgaaagaggca
acagatgatgaatggatcattagcacaccacacactggcgtccaagccactaactacaca
gtaaagaaacttaaggagaatgcggaatacaacttccgcataagtgctgttaattgtgag
ggagtaggagaacatgtagatttgccttgttctgtgattgctgcagagaagctggaggct
cctgaaattgaactagattgtgacctaagaaagatggtcaacgtccgtgcctctgctacc
ttgcgtctgtttgtgacaaccagagggaagcctgagcctgaagtcagatggtcaaaggct
gatggcactctaaatgaacgtgcccagatagaagtcacaagctcttacacaatgctggtg
attgagaatgttgacagatttgacactggcaaatatgtgctgacccttgaaaacctcagt
ggctctaaatcagcctttatcaacgtcagagttctggattctcctagtgctcctactaac
ctcggagttaaggatgttaaaagaaattctgtctctctctcctgggagcctcctctaatt
gatggtggggctaagatatcacattatatagtggagaagagagaacagaagagaatggct
ttcaccagtgtttgcactaactgcgtcagaaactcctacattatttcagacctgcaggaa
ggaggccgatactatttccgtgtgttagctgtgaatgaactcggagtaggtctgcctgca
tccacagatcaagttaaggtgtctgagcctcctctgcctcctggtaagattgtggttgtt
gacattactcgtcatgctgttacactctcttgggagaaacctgatcatgatggaggcagt
aagattacaaactatattgtggagatgcagcccaagggagatgacaaatggacggtgtgc
agtgaagtcaaagcacttgaagctaccattgatggactcacaactggagaggaatactcc
ttcagggtaactgctgtgaatgataagggtagaagcgatgctaagcctctggctactcct
gtggtggtaagggacatcacgatggagcccatcatcaacctgttattcaccacatacagt
gtaaaaacaggagatgatttgaagattgacgttcccttcaaaagcagaccacagcctgag
gtgtgctggaagaaggatggccaagtgcttaagcagacaaccagggtaaatgttctcaat
tcaaaaacctcatctaagattgtcatcaaggatgccacgaaggaggatgtagggaagtat
gtgattaccctgactaactcagttggtaccaagtcagctgaaatctctgttataatcctg
gataaacctggaccacctagtaacattaaggttgatgaggtgagcgctgactttatttct
ctgtcttgggatcctccaacctatgatggtggttgtcagattaacaactatgtagttgag
aagagagacactactactacaacatggcaaatcgtgtcagccacagtggccagaacatca
ataaaggtttctcgacttactcaggggacagagtaccagttccgcattgcagctgagaac
cgttatgggaagagtcctgccatagattctgctcctgttgttgctcagtatccatttgag
cctcctggccctccaacccaacttcatgttgtccatgccaccaaaactgggatgctcgtg
gtatggggcagacctgcaagtgatggtggaagtcctgttattggttatcacattgaaagc
aaagaccaaagcagcatcttgtggaccaaggtcaacagaggtctggtgactgagaaccag
tttaagatgacaggaatggaagaaggtctgttgtatcagttcagagtgtatgctgagaat
attgctggaattggtccatgcactagggcaagtgaccctgtggcagccagggatccatgt
gaatctccacataaccttagagtcacaaacatcactagaaattcagtttctcttttttgg
gaaagacctgaatatgatggcagtgcaaaaattactggctacattgttgagcgtcaagag
cttcccaatggtcgctggctgaaatgcaacttcaccaatgttcaagacacttacttcgat
gtcactggtctcacagaagatgtccggtatgatttccgtgttattgctaaaaattctgca
gagcaattgagtgctccttcagaaagcactggacccgtcactgtcaaagatgatgtagat
cctcccaccattatactggaagataaattcagacagttggttgtcattaaggctggagaa
atcattagaattgatgccgaaattactgggcgtccactcccagttgtttcatggtctaag
gatggtaaggagattgaggccaaggctagatgtgaaatcacatccactaacttcacaacc
acgctcattgtcaaagatgctatcagaagggactctggacagtatgttcttactctgcac
aatgtagctggaaccagatctgtggctatcaactgtaaggttctggacagacctggacct
gcatcaggacctttaacagtttctggtctcacagcagagaaatgcaccctgtcatgggga
ccacctcaggaaaatggtggtgctgaaattatgcactacattgttgagaaacgtgagacc
agtcgtcttgcctggactcttgtctatggtgacatgaaggcaactacctgcaaagtgact
aaactgctcaaaggaaatgagtacatcttccgagttaggggagtcaacaaatatggagat
ggtgaaagcctggagagtgagccaacaaaggccactgatccattcactgtcccttcagct
cccactaatgtccaggtcacctctgttacaagtgaggcaatgaccatttgctgggaaaga
cctgtttctgatggtggcagcagtattgctggctatgtaattgagaagcgagagaagact
ggcctccgctggtgccgtgtcaacaagaaacctgtttatgaccttagagtgaaagcttca
caccttcgcgagggctgtgagtacgaatacagagtttttgcagagaatactgctggcctc
agtgctcctagcactccttgcccactcaccagggcagaagacccacagtttttaccctca
cctccagctaagcctaggataattgactccacaaagactacagtcaccctgtcatggaat
aagccactttttgatggtggagcacctgtgactggttacagagtagaatacaggaagaca
ttagatgatgaatggattgttggagtacagaacaccaaaaacacagaatttacagtggtg
ggattatcacctggaactgaatatgtgtttgttgtcaaatccattaacaagattggagtg
agtgagcccagtcctgaatcagacaaacaagttgccaaagaaagagaggaggagccaacc
tttgatgttagcaatgaaatgagaaagactcttattgtaaaggatggaagctctttcaca
atgaaagttcctttcaaaggcaaacccatccctagtgttacttgggctaagcctgatgta
gaccttagagttcgtgctgtaattgacaccacagatacctttacttccatcaccttagaa
aaagcaactcgaaatgactctggaaaatacactgtcactctatccaatgtatctggtacc
tcctctttgacgctcactgtccgtgttttggactcacctgggcctcctagtcatatagag
gtcaaggaagtcacaaagacctctgctactataacctgggatactcctgagattgaggga
ggaggaccagtcaagaattaccttattgattaccgtgaggctagcaagaaaggctggact
agattgactgacacatgccacagactgacatacaaggtggcagacctgcaggagggagaa
gtctactacttcagagtgacaggcgagaatgaatatggtattggtgttcctgctgagacc
aaagaggggaccaagatcacagaaaaaccaagtccaccaccaaaactgggtgtaacggat
gtgaccaaggaaagtgtgtccttggcatgggccaagccagaacatgatggaggcagcaga
attactagctacctagtagaagcactggagaatggacaagagaagtgggttaaatgtggt
acaacaaagtccatccacttcacagtgtctggtctgagggagaatgcggagtacttcttc
agaatcagagctgagaactatgctggattcagtgatgctaaggaaatgattactcctgta
gtggtcaaagaccagcttgaatctcctgagatcaacatgaaggacttcccccacaataca
gtatatgttagagctggatctaccctaaaatgtgagattccattgacaggccggccttta
cctaaagtgactctgtccaaggataatgtgctgctcaaatcaacaatgaggtttaactca
gaagtcactcctgacagtatcaagattagtgtgcgtgagagcattgcaggagactcaggc
cgctatgatattattgcctccaactccagtggaaccaccaagtcctttgtaaatattgtg
gttcttgaccgccccagtgtcccacttggaccagtggagctgtatgatgtcacagaagac
agtgtaagcttaaagtggctcccaccagcatatgatggtggcagtcccatcaccaactac
atcatccagaagcgagagacaactacagccaactggatggacgtgtcttcagctgtggcc
cgttgcaccatgaaaattatgaagctgaccactggcctggagtaccaattcagaattagg
gcagagaacagatatggaatcagtgaacatattgactccccagctgtcgctgtcagtctt
ccttacactataccagatgtgccatcaactccagaaattactgctgtaaccagggaaagc
attaccgttgcatggaaggagccaaagtcagatggaggcagccatgtgtttggttaccat
ctccaaatgaaagacaaaaacagcatcctttggcagcgagtcaacaaaacagtgatccgt
gccacacactttaaagtcaccaacataaatgctggacttatttatgagttcaaggtagca
gcagaaaactctgctggaattagtgccttcagcaagatttctgatgctgtattggctatt
gatgcctgcgagccacccctatacttgcgtataactgacatcactaagaactccattagt
ctggcctggcagaagcctgactatgatggtggatccccaataactggttacatcattgag
aagagagagggtgttagccccaaatggtctaaagctaacctcaccaatatcacagacacc
cgcttcattgttactggcctcacccaggatgaaacatatgagttccgagtcatggcaaag
aatgcagttggttcagtgagcaatccgtctatcactgtggggccagccacatgtgtggac
acttatggtgccccagagattgaaatacctcaggagtatcttaatgaggtcaagcacaag
gctggctctaatgtggaactcaaatttaatataagagccaaacctgctcccagtattgag
tggtttaaagatggcagagagcttaagcctacttctcagctctcttttaaacacactttc
gagtccacaagtgtgttcgtgaaggaaacaactcgtcttaactctggaacctatgaagtc
aaggtgaagaactccctcggatcttcatgtgccattgtcaggctgctcattcaagataag
ccaggcccacctgctggagagattcagtttaagaaggtgacagctgacaacatcaccatc
atgtggtcaccacctgctgatgaaggtggtgccatggtgacacattacattgtagaaaag
cgggagaccagcagggtaatgtggtcgattgtctcagagaaactggttgactgcattgtg
aatgtgcccagactcataatgggcaatgagtacatctttagagtccgtggagtcaacaag
tatggcattggagagccactggagtctgagcccattattgccaagaatgcatttgtacct
cccagcgagccatctaagcctaaagttactatgatcactaagtctaccatgacagtgatc
tgggaaagaccagcgttggacggaggcagtgatattgatggctactatctagagaaaagg
gagaagaggagtctgcaatggttcaaggtggtgaagggcactatcagagacaccaggcag
aaagtggctaacctggtggagaacaatgagtaccagtacagagtgtgtgctgtcaacaag
gctggagcagggaactactctgaaccttctgagctctataaagcctatgacccaatagat
ctaccaggtgaacccactaagctgcgtgtggttgactctacaaagacatctatcacactt
ggatgggagaagcccgtctatgatggtggcagcgaaattacacactatattttagagcag
atgaatacagaggacaaagaatgggtgattaccaacccacaagtcaagacatgtgagtat
gtcgtgtcccacctcaaacctggcatctactacttcttcagagtatctgctgtcaactgt
aaaggcaaaggagaagacatcaaaatgtaccagcctgtgcaagccaaagatattttagag
gaggctgatctggacttggatgttgctatgacaactcaatacacagcaaaggctggccgt
gatgtggaagtctttatccccctgaagggtcgtcctacaccaaatgtcacctggcgccgt
ggtgaccgtaacatggctggtgataaccgctacacagtcacaagcactgaaagagctacc
acactcctcatccccaaggtcacccgtgatgactgtggaaagtatgtgctggaaattgag
aatggtgttggagaacctaagatagttactgtttccctcaaggttctggacagtccatcc
acctgccagaaactgatgataaagaatgtcacaagaggaaagctgacactaagctgggag
cctccgctcatagatggtggctcccctgtgactaattacattgtcgaaaagaaggcctcc
actatgaaagcttatcaagtgattactgatgagtgtttaaatacaagttacaaggtgtca
gggctggaggaagatatagcttacttcttccgtgtgtctgctcaaaatgagtttggtgtg
ggtgacccttgtgaaaccactgatgctgtccgagcaactgaaactccaggagctgttaaa
gacctaataatggtggactccacaaagaactctgtcacccttcagtggagcagacctgac
cacgatggtggcagccacatcactgactacatcattgagaagagagcccaggatgaagtc
aaatggactttagctgctaaatgcaagcggtgcagctgtgaagtgacgggactcaaggaa
aatgctatcctggatttcagagtgtttgcaaagaatgagaaaggcaacagtgacttctcc
caaattggtccgatcacagtgatggacctcatcattccacctgaagccaaactgaatgat
tatcccaatggagagcttgctgttcgtataggtcaaaacatccatattgagttaccattc
aagggaaaaccaagacctacaatcagctggctaaaggataatttcccactaaaggaaagt
gagaagattcgctttaggaccactgacaacaagacttcagttacagtcagaggggttaag
aaagaacatgctggacaatacaccttggttctggataacagagtcattaagaactacttt
gacatcaatgtgatcactctgggacccccttcagtccctactggccccatccgttttgac
gagataaaagctcagagtattattatctcctgggatgagccgaaggaagatggaggtggc
gagatcacctgctacagtgtggagaaacgtgaaacctcccaggccaactggaagatggtc
tgctccagtgttgtcaggactacctttaagattcctaacctggtcaaaggaactcagtac
cagttcagagtccgtgcagaaaataagtatggggtcagtgagccactcatctcttcagat
gttgttgcccagcaccagtacaaacctccaggtcctccaggaaaaccagttgcctacaac
atcaccagtgatggtatgtcaataaagtgggatgccccagattttgacgggggttcccca
gtcttaggttatcatgtcgagaagaaggacaggaacagcctcttatggcagaaagtgaat
tccacaaccatctctaacagagagtacaggataattggtcttgtggagggtctggagtac
tcctttagagtctatgcagagaacaatgccggactcagcccttgcagtgagcagagcaaa
catgcactcgctatctcccctgttgatccacctggtaccccagtctgcattgatgtaacc
agagactcagtcaccctccaatgggacattcccaagagggatggtggaagcaaaattgta
gcctatagtgtggagaggcgtcaaggcagaggcaaatggctacggtgcaacttcactgat
atcagtgagacccagttcactgtaactggtctctcacctggagaaagaattgagttcaga
gtgattgccaggaatgctgttggcacagtcagcccaccatccaactcctctggatacata
atgaccaaggatgagagcattgctcctgagattgagtggtctccagaccaggtgctcacc
ctgagggctggagataacgtcagtctcagctgcaaaatcaccggacgtccagtcccacag
gttctttggtacaaggagggtaaagagatcgacaagaggactatgattgacattgagatt
actactggcattggcaccagtagtctgtttattcgcgattctaacaggaaccaccgtgga
atttacactgtagaggccaaaaatagctctggaaccaggaaagctgacattaacgttaga
gtccaagatacccctggacccgtcgagggcccaatccgtttcacaggcatcacagctgag
aagtgcactgtgtggtggagcccaccagagaacgatggctgtgctgccatttctcactat
gtggtggagaaaagggagacatccaggatcacttgggccttggtcacctccaagtgtgaa
gcttgctcttataatgccaccaacctcatcaaaggcaatgagtaccagttcagaatctct
gctgtcaacaagtttggtgtcggaaaaccactggactctgatcctataattgcgaagatg
caatacactgttcctgatgcccctggtacaccagatgccacccatgttactggagacagc
ataacgctgtgttggaccaggccacggtcagacggaggcaatgagattaaatgctacatc
ctagagaggagagagaagaagagcttgcgctgggttaaggtctcctccaagaggcccatt
acagagttaaggcaccgtgtgaccaaacttactgagggcaatgagtatgagttccgtgtt
atggctgaaaatggtgctggtgttggaccagccagcagcacctccaggctcttcagatgc
agagaaccaacaagtgctcccagtgctcccactgtaatcaaggtcattgactccactaag
tcctctgtcaccctggaatggaccaagccagtctttgatggtggcatggaaataattggc
tacaatatagatatgtgtaaggccagtctggaggagtggcacagagtcaacagacagatt
tgtattcacaccaggtatactgtcacaggtctagtacctggagaactctacaagttcaga
gtcagtgctgtaaatggatcaggagagggcgaagcatcagtgatgccaaaccctgttcag
tctttggacagacttacatctcctgaaattgatcttggtcctgacttcaagcaaactcat
attgtgaagaatggaggcactataaccctacatattgctttccgaggaaagccagctcct
ctagccacgtggtctaaattagacagtgagcttccgataatggctgatatcaacaccaca
gattcattttccactctgaccatagagaactgcaccaggtatgaggcaggcaaatacacc
ctgtccctggagaacaacagtgggcgcaaatccatcacattcactgttaaagtactggat
actcctggacctccaggagccataaccttcaaagatattactcgcggagccttgacagtg
atgtgggacgctcctgccactgacggtggatcccgaatccaccactacattgtggataag
cgtgaagcaagccgccttgcctggcaagaagtcagcaccaagtgctcacggcagatgatc
agagtaactggtctggaaattggtgtaccgtatttgttcagagtgattgccgttaaccat
tatggccagggagaaccaaaagagatgactgagcctataattgccacagaagaacctgcg
ccacccaagagattggatgttgttgacacaaccaattccacagcctcactggtatggcta
aaacccgagcatgatggaggcagccgcattagaggctatattgttgaattcagggctaag
ggcactgaccactgggttgttagtggagagactaagtctcagaagatgttggtagagggt
ctgattgagaacacagaatatgactttagagttaaagccaagaatgatgctggaattagc
gaacctcagggcacctttagctctgtggtcataaaggagccttgcatagaaccaactgct
gatctcagcagcatcaccaaccagctcatcacttgcaagacttccaacaccttcacaatt
gatgtccctatcagtggcagacctgcacctaaagttacctggaaactggaagagatgaag
ctgaaggagactgacagagtctccattaagacctcaaaggaaagaaccattttggtagtg
aaagacagcaagagaagcgacagtggcaagtactacctgacactggagaatgctgctggt
gtgaagacattcacagtgactgtggtcatagttggcagaccaagtccacccacaggacca
gtagaaatttctggaatctcttcagagtcctgcaccctttcttggtctgagccagctgat
gatggtggtactgacatcagcaactacattgtagaaaaacgggaatctggctctgcttct
tggcaagtggtgaactccagtgtgaagagaaccaccatcaaagtcacacatctcaccaaa
tacatggagtacacatttagagtctgtgctgagaacaagtttggagtcagcaagtccgtt
gagtctgcccctgttgtcattgagcatccatttgttccaccaagtcctccaactcgccca
gatgtgatatctatatctgccaatgccattagcatcaaatgggatgttccatatgctgat
ggtggcagcaaggtgacaggctactggattgagaaaaaggagaggaacacgatcctgtgg
gtgagggagaacaagctaccctgcctggattgccaatacaaggtctcgaacctgattgag
gggctagagtatcagttcagggtgtatgccatgaaccttgctgggctcagcaaagccagc
gaagcctccagacctgtagtggcactcaatcctgttgatcctcctggcaaacccgaggtg
acagacatcacccgctcttctgtgtcattgtgctggacagtgcccttcaatgatggtggc
agtaagatcattggttatgtggtggagagaaaagtctacagcacagatgagtgggatgac
aaccgctggctcaagtgcaactataccacaatcacagagaactacttcaccatcacaaac
ctaggtgaaggagagacctatgaataccgtgtcgttgccaagaatgctgcaggtgttcaa
agtgtcccttcagagaccactggaccagtcacatgcaaggatgaatattctcctcccaaa
gctgaacttgacagcaaactgataggtgagactgtcactgttactgctggttctgacctt
gtcttggacggtgctgtgggtggtaaaccagagcctacagtgtactggtcaaagggtgac
aagattttagaacttggagaaaaatattcactgacctacactgccactagagccatggct
gtcatcaagagctgtgacagatacgacacaggtagatacattctaactgtcaagaatgcc
agtggaattaagacggcagctgtcagcgttaaagttctagacactcctggagctccagct
gataggattgtaatcagcagagtcacagaggaaaaatgtacagtgtcttggaagatacct
ctggaggatggtggagactctgtcacccattacattgtggaacgtcgtgagaccagccgc
ctcaactgggtcatcatggagactgagtgcaagaccctgtcatgtgtcagcactaggttg
atcaagaacaatgagtacatctttagggttagaggtgtcaataagtatggggctggagtt
cctttggaatctgatcccatcatcgccagaaacgcttacacaatcccctcccagccaggc
acaccagaggcgactgcagtgggtaaggagcacgttatcatcgagtggctgaagcctgag
agtgatggaggaagcgagctcaaaaactacatcgttgaaaaacgagagaagaacagtagc
aggtggactcgagtgaataagacctacaccatctatgacacccgcctgaagatcacaggc
ctactggagggaagcgagtaccagttcagagttacagcagtcaactctgctggatacagc
cagccaagtgacacctcagtatacatcctctgtaaagaccccacatacaccccagctcct
ccatcagtgcctcgcatcacagacacaacgaaacacagcatcaccatgacttggaccagg
cccatgtatgatggtggatcagatgtcaccggctacattgtggagatcctagaggagggt
tctgagcagtggtaccgtgccactgccaaagccctcaagactaatgagtatgtggctgct
ggtttggctgccaataagaagtacagattcagggttgctgccattaacagcaatgggact
ggagagttcagtgaaccaagtgctgaaatcgaaccacttgagaaaattgaaatacccgat
ttggagctggctgatgacctaaagaaaacagtgtgcctccgcgctggaggtactctgcgc
ctatttgtgtctgtcactggtcgtccgacgccagtagtggcctggaggaagacgggggtg
gaactacagagccgtggttatattgagactactgacaagtacacatcactggtagtagag
aaggttgatcgctacgactctggaaaatacattgtagaggcagagaacccatctggaaaa
aagactgccatcatccttgttaaagtctatgacactcctggtcctccaggttcagtgaaa
gtgaaggactacaccaaggaatctgttgtgatcacctgggatgtcccaagcattgatggt
ggtgctcatgtcagcaactatattatagagaagcgtgaggccaacatgaagtcctataag
actgttaccactgagtgtaggaaaacactgtacagaatcagtggactggaggagggtgtg
tactactttttcagagtcctgccagagaatatctatggtgtcggtgagccctgtgagaca
gcggaggctgtgctggtgtgtgaagtgccctcagtgcctgtgaagcttgagattgttgat
gtttccaaatcttctgtcaccctgcactgggagaagcctttgcatgatggtggcagcaga
ttgacaggctacattattgaggcctgcaaagtaggctccgacagatggagtgctgtggcg
acagttaaggcctcagtatcccagcacaccatccagtctctgacagaaaatgaccagtat
ctgttcagaatccgcgccacgaacagcaggggagccagtgaatccactgacattgtcact
ccagtgatcatccaagagatcaaggttatgcccaagattgacatgacaagtatccctcag
aagatagttcatgtgaattgcggcaaacccattgacctcaacatcccaataaggggcaga
ccacagccagtctgctcgtggtactttggtggtgtgaagctgaaggacaccctggaccgc
atcaagattgacagcaccagcaaatatacccatctcgtcatccgtgagacgaccatctct
gacacaggagactacacactagaggtgaagaataccataggcatggcaactgaagttatc
aaggttatcatcctggacaaaccgagtattcctatgggtccagtaaagatcgaggaagtc
gacggtgtttcagtgacagttagttggctacctccagagaatgatggtggtgccaatgtc
agcggatatgttgttgagcagcgtgatgcccaccggcctggctggaccaccatctccgag
tctgtgacaaggccttgctttaaattcactaggctctctgaaggaactgagtacgtgttc
cgtgctgcagccatgaatcgttttggcattggtggcttcctgcagtctgatgtggtggaa
tgcaagagcgccaagaccatccccggacccccaagcaggccagaagtgcttgatgtcacc
catgagggcatgaccctgacctggaaaccacctgaggacaatggtggctccactattgcg
ggctatatcatagaacggaaagaggcccattctgacaggtggttgaggatcaacaaaaac
cctgttactatgaccaggtaccgttcctccggactgattgagggcctggagtatgaacac
cgtatcacagccattaactctagaggggctgggaaacccagcgagagttctgtcattacc
atcgctttagaccccattgaacctccaggtcctccagttcaggccagagtcacagacact
accaggacttctgtttctctagcttggcttccaccagaagaggagggtggttctgtcatt
actggctactttattgaaatgcagaaggtagaccagctggaatggacactgtgtaacaca
actcccacgaagatgtgcgagtacatcatcacccacatgccacagggggctgaatacaaa
tttaggatcatcgcctgcaatgctggtggttgtggagaagctgctgagattcctggagtg
gttaaagtccaggagatgcttgattatcctgactatgagctggatcctaaatatgaagag
ggctatgtggtcagacaaggtggtgtcatccacctgtctgtacccattaagggtaaaccc
atccctacatgcaagtggaccaaggatggtcgtgacatctcccatcgggccatgattgct
acgcatgatgacatcactgagctggtcatcaaagaggcgcataaagatgacactggtacc
tacgacttggtgctggaaaacaaatgtggcaggaaggctgtttatatcaaggtgaaagtg
attggtcgcccagatgtcccagaagggcctctggaatttgacgacattcaggcccgatca
gtaagagtcagttggaggccaccatcagatgacggtggagcagacatcctgggatacata
gtggaaaggcgggaggtacccaaggctgcctggtatacagtggatgctcgagtaattggg
aactctctagtggtgaagggcctaaaggagaatgtggagtaccacttcagggttgctgct
gagaatcagtttggtgtcagcagagctttaaaatctgaagagtctgtcacaccaaagact
ccactttgcccacctgaacctcccagcaacccaccagagatcatggatgttaccaagtcc
acagtttctctctcctgggccaggccccgcgacgatggaggctctcgtgtcactggatat
tatgttgagagaagggaggtttcaacagagaagtgggtccgccacaacaagacccacatc
accaccaccatgttcaatgccactggtctcatccctgatgcagagtacatgttcagagtt
gtcgcacaaaatgacattggacagagcgaacctggtcctgcttctgaatctgtagtctgc
aaagatccatttgacaaacctaaccaaccaggagagattgacattgtctctgtcactaaa
gactgtatcaccatccactggctcaggcctgagcatgatggtggcaaggagatcctaggt
tactggattgagttcaggcaggctggagagagtgcctggaaaaaatgcaataaggagcgc
tcgaaggatcgtcagttcaccatgggtggcttaatggaagccactgagtatgagtttaga
gtctttgctgagaacgagactggactcagccgacctcgtcgcacacctatgggcatcaag
accaaattgagtgttggtgaggctccagctttgacagaagacatccaagatgtaacaact
aaacttggcgagtctggcactctgacctgtggcattattggcagacctctgcctgagatt
aagtggtaccgctttggcaaggaactgatccagagccgcaagtacaaaatgagctcagat
ggtcgaaaccactccctcagcattctaacagatgaacaggaagatgagggcctgtacacc
tgtagggcaatcaatgaggctggagagatcgagagcagtggtaaactgcgtttacaggca
gctccccagtttcaccctggctttcccctgaaggaaaaatactttgctggggctggcacc
agtctccgccttcatgtcgtatacattggccgtcccatcccacagatcatgtggttctat
ggcaagaagcctctgaatccatctgaaaatgtgatcattgaaaacacagagagctacacc
cacctcgtggtgaggaatgttcagagaaagaccaacgctggtcgctataaggtgcagctc
agcaatttctttggaactattgacactgtgcttcgtgtagaaatccaagacaagccatgc
atgcctgaggggcccctaattgttgaagccctgcttaagagctcagttgtcatcagctgg
aaggctcccaaggatgatggaggatcaatgattaccaactacattgtggagaaacgggag
gccaaagaaggggaacagtggtacctggtgtcctcctctttgtctggaaccacctgccgt
gtcctcaatctgacggagaatgctggctactacttcagggtttcagctcagaatcaatat
ggagtcagcgagcctctagagatcccatcagtggttataatcaagagtccatttgaaaaa
cctggcatcccacagcagcctttcattatcagctccacaaaggactcttgtgttgtctgt
tggaagcctccaagcagcgatggtggagctaaaatcacaaactactacctggagaaacgt
gagaagaaacagaacaagtggatgtcagtaactaccaagaagattgcagagaccaactat
gaggtcacaggcttgattgaaggcttcgagtatgagttccgtgtcaaatgtgagaacatg
ggcggtgagagcgaatggagtgagatttctgaacccatcatccccaagtctgaccagcct
cctcgcactcccacattcagggaggagatcagagacatgactgtcaaataccatgccagt
gcaacatttgtcactaaggtgttgggctatccaaagcctgttgtgaaatggtaccgtagt
ggaaaggagatcctggcagatggaactaagatcaaagcgctggagttcaagggaggctac
tatcagcttgtcatcacttctgctgatgagaatgatgccacagtttaccaagtcagagca
actaattcctcaggatccatctctaccacagccaacttggaggtggaagttcctgctaag
atctatctgcctcaagagctccaaggaatgggcgcagtccatgctgtccgtggtgatcac
atcaccatcaagatccccatctctggcaaacctgagccaacaatcacttggcagaaaggt
caggagatcctctccaactctccttatcaccaagtcatcaccacaaggtctttcacatcc
ctggtattccagaagggagtccagaggaaagatactggctactacattattactgcaaag
aacaggtttggaatggacaagcaaaccatcgaggtgaatgtggccgacattcctgaagct
ccaaaaggccttgtggttagtgaaattgcaagggattctatcactcttgtctgggagccc
cctgtcagtgatggtggaagcaacattattaactacattgtggagaagtgccccaccacc
agtgataggtggattcgtgctggacaaacgactgactgtagtatcactatcatcaacata
tttggaaaggccaaataccagttccgtgttattgcagagaaccagtttggtctgagccca
ccatctgaaccaactgagcctatcaccacaaaggaagacaagtctgtaattaggaactat
gatgaggaagtggacgaaacaagagaaattactaaagaggaggctcttttctacaaggtg
aaggagctgtcctcaaagtacattatctctgaggagcttgctcactgccagtttggtgtg
gttcaccgttgtattgagattgccacaaagaaaacctacatggccaagtttatcaaagtc
aaaggaactgatcgtgagttggttttgagggaaattgaagctcttaatgtgggaaggcat
aagaatatcatctacttgcatgaatactttgaaagcatggaggagatcatccttatcttt
gaattcatttctggagttgacatctttgagcggcttggcaccagcaactttgagcttaca
gagcaggagattgtcaagtaccttagacaagtctgctctgctctcaagttcctgcattcc
cacaactttggccactttgatatccgcccagacaacattgtgtacactacaaggaaaagt
accaacataaagatcattgagatgggccaggctaggcttctggtgccgggagaaaacatc
agaatgctcttttcagcaccggagtactgcgccccagaggtccaccgccatgatttggtc
acaacggccacagatatgtggtctgttggtgttatggcctatgttctactcagtggcctt
aatccatttgcagcagagtctaccacaaagatgattgagaatatcaccaactgtgagtat
gtcttcgacagtgaagcatttaaggatatcagcctggaggctatggactttgttgacaga
cttcttgtcaaggacaggaagcttcgtatgacagcccatgaggctctggagcacccatgg
ctcaagatgaaaatagagcatattagcaacaaggctatcaggacactgagacacagaagg
tactatcagactctggtaaagagggttgatactattgtatcagcagctcgtgtggcctat
ggtggtgctttcaagaaccagaggggattggctgttggtaaagtgaagattggaactgag
tgccatggcttccgtgctggcccagtcatgcatgcctcagctgaagaaggtggttatgca
agattcacttgcagcattgccaagcatgacaagagtacacaggtgtcatggtactttggt
aactgccagctacacacaagccacaagtatgagattacttatagtaatggctttgccagt
atctacgtaaaggacattgaagaaagtgatgatggtgtgtacagatgcaaagtgctgagt
gatgatggagaagacagtgcttatggagagctttttgtcgagacagtgaggagtatcaaa
gagtactatcttagccgctccatcaagaaattaaggaggagagttgacaagactaagctt
ctgcagagaccaccagagttcactttgcctctctacaaccgcaccgctttcattggcgaa
gatgtgcgttttggtgttactgttactgtgcatccagagccttgcataatttggcttaag
aatggtgaaaaaatcaagccaggtgataatgacagcaagtacacgttcaccagtgataag
ggtctataccagctcatgatccataacctggacatgactgatgatgctgaatacaccgtt
atggcccacaacaagtttggagaagacagctgcaaggcccgtctcactgtggcaccacat
cctgtgacagaagaaactatgaagcccatgttcaaacgcctgctggctaatgttgagtgc
atggagggacagagtgtccattttgagctcagagtctcaggtgtaccacctcctactctt
aaatggcaaaaggatggtcatccactacagtttggtcccaaggtggttgtcatacaggag
gacgttgactctcatgtccttcacattagagagactctacttgaggactctggtgtttac
aaagttactgcaaccaactctgctggcaccgccagctgtcaggcaacattgaaggtggac
cgccttacctatacaaggagagaatataggagtgaggaagagaaatacatgcacatacag
aaacaaattgaaaagaccaacaagatggctcagaaaatcgttgctactgaggagcttgta
ccgcttaatcccactgctcaagaagctctcaaatatgctgcagagatttacaagccagca
gtgagcacgaagaatgtcgagggtgagtttgacatcaaagaggagaagtcagagaccaag
aagttggaggaggagaggaggatcttcatgccctatgaaattcctgagcctgtggttcat
gatcccagagttcttgatgagaacaaaggtatcaaactgtttgtacctctgtcagatatg
aagtggtacagaaagctaaaagatcaatatgagatttcagagaggatggagaggattgtg
cagaagagacagaaacgtattcgtttgtccagatgggaacagttctacgtcatgcccctt
cctagaatcactgaccagtataggccaagatggcgtattccaaaactcactctagatgat
ctggagactgtcagacctgcacgccgctctcccagtcctgtgtcagaggcgttgttcaga
tctaggaggagatctctgggagaccttagcgatgaggagctgatgagaacagaggaagaa
gaaggaatgatgttggaggatgaactggagcttggcttttctgcctcacctgctggcagc
cctgtacgcattgagcgacgtgccatggagcatgaggaaagaaggcaggaaggtagacat
gaaaccgttgaggttgctgagacaaagaagaaacgtaccatctctcagtatatgaggagg
agaaggtcactgtcacccacttacattgagctaatgcgtccagtttcagaactgataaga
caaccacatgctaggcatcctgtggaagtagagggagagattgtggggaggaggtcccct
accccagagaggacccgaccacgttcccccagccccatcaagtcagttgaaaggtcttca
cgctcctcctcgaggtttgagcggtctgcccgttttgatatcatgtcccgttacgaggcc
agaaaggctgctctgaaatctgaaaggaagtatcagttggtcagtcagacacctttcagt
ttggaccatgccccgcgtgtcactgttaggatgcgttctcatcgtatcccagttggtcaa
gatacaaaattcaccctaaatgtacaagctaaaccagaggctgaggtcacgtggttccac
aatggaactgcgatctctgaatccagtgagaaattcatctttaccaacatgactggtgtc
ttgaccatcactattctggactgtcaggaagaggatagtggcacgtatcgctgtgtatgt
tccaactctaagggagaggcttcagactatgctaccctggaggtgtcaggtggtagctac
acaactttttcttctcgccgcaaggatgaggaagctcccaaagcatatgtccctgaagtc
actcgaacagaccactaccacatctcccacttcaaagctggctatgcttcacagacccac
tttgaggtagaagaaaccaaatctaagttaaccgaaacacatgaggtattcacacatgag
agatatggcgcctcctctgaaaggtactcctctgctgagaggtatgactcatctatcaag
tatgcttctgctgaatacctgtcatctagttcctcttattcatctgacaaattttctctg
agtgggaaacacaccatatctgaagctaaactgaaatcctctaccactgctggtgatgag
gaagtttctgtccagaaggcaaaactttctcttccagctagaatcctcactaagcctcag
tctgtgacagttgaggagggagagactgtcagatttacctgtgatattgatggtgagcct
gcacccactgtgacatggatacatgagagcagaaccattgtctcatcccaccacattcag
gtcaccacaactcagtataaatccagtttggaaatctcctctgtgacagcctcccatgag
ggcagttacacagtagtggtagagaattcagaaggcagacaggaagctcattttacttta
accatccatagagcaacccccaagcaggaagttaaaatagtcaaaccccctgagccatcc
gtgaagtcacccactcccagtgtaaagtcacctgcaccttcagccacatcccctattccc
tccacaacctctgctgttcccagtgtgaagtcaccagaacctagcaccaaatccatcgag
ccttcagttacatcaccagcttcaagtataaaatctcctgaaccaagtgcaacatctcct
gctccaagtgtgaagtccccaacaccaagtgtgaagtctcctgaacccgaggggattaag
tctcctaagaccataaagtctcctgaaccaactgcaccttctcctgcaccgagcttaaaa
tcaccgactccaggtgtcaaatctcctgagcctgagggacctaagtcaccacgaggtcta
aaatctcctgagccacgactcaagtcaccaccgccaactaagaccctggggactggaaag
tcactggaatctgaggaagtaaaatcaccccggggtatcaaatctccagaacctacagga
atcaaaatgccaagaggtgtcaagtccccagaacctcctggactcaaaacaccaaaaggc
atcaagtccccagaaccagcaggcatcaaatcaccaagggcactgaagtcccctgaacct
gaagggatcaaatcacctcctagaatgaagtctcctcctcccaccatgtcccccaagaga
gttgtatctccacccaccgtaaaatccccaatcccaaaaccccccaaggtcatgagtcag
ctaacagcagaagcctgtgaggggtcagtgaggatgtcctgtgtttgtgagagctccgtc
agagaggtggtatggtatgtgaatgggaggaggctttcacaaagcagtcgcctagagatg
cactattctgagggttcttgcagccttttgatccataatttaacagacagtgatcaggga
gagtacatctgtgagatgaaatcagaaggaggagtatccaagtcttctttcaacttcact
ggacaagtgtttcagtcaattcgcaagaagattacagcttattgtgaacagcagctggga
cttcaagaatcagtattgatgagtcaaaaggagtcatcgtcatccttgagttcatcggtg
atgatgaagaaagaaatccatacaatggaggagtcgtctgccttttcttctacttcccag
caggcagtgatgtcatccatgacggattcccgctccttcagcagcatggcagctgaaatg
aagtttgagaccatgtccatgtccagcatgtcctccgtgtcatctgaggcatatgccatg
agctccagtagcctcatggagatggcctcccacatggagggatcacttagagctcttggt
tctgctccaaggattgaagctctgccagaggacatcagcattgagcctggcaaagtcctg
acagtcgcctgtgccttctctggtgatgccagacacattgagtggtcgcacgacggcaaa
aggattgagttgactgctgccggacgcttccatattgagaccactgaggacttgaccacg
ctcattatcactggggtgaagaaggaggatgctggaagctacaccctcaaactgtcaaat
gagctgggatctgatacagcaactgttcacattagtattcgatcggtgtaa

DBGET integrated database retrieval system