KEGG   Maylandia zebra (zebra mbuna): 101472801
Entry
101472801         CDS       T02814                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mze01002]
    101472801
Enzymes [BR:mze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     101472801
Peptidases and inhibitors [BR:mze01002]
 Metallo peptidases
  Family M1
   101472801
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Peptidase_M9_N
Other DBs
NCBI-GeneID: 101472801
NCBI-ProteinID: XP_012773537
Position
LG12
AA seq 959 aa
MISAEAACRRRSGPASVVTMLVAPLLLVLFVPFSPSSGAQLPNQAKAKDLPIATNGQPFP
WDRMRLPTTVTPLHYDLAIHPNLTTLDFTGVVRIELDVHEDTNTVILHAKQMQISNVFLL
APEGIKRLKVLEYPRFHQLALLSDSVLIKGRKYEVHLAFAANLSDSFHGFYKGSYRTSSG
EVRVLASTQFEATFARGAFPCFDEPAFKANFTIRIIREPRHIAISNMPMVKTVELPGGLL
EDHFDTTVKMSTYLVAYIVSDFKSVSKTTQHGVKISIYAVPEKIDQTAFALDAAVKLLDF
YDDYFDIPYPLPKQDLAAIPDFQSGAMENWGLTTYRETGLLFDPEKSSASDKLGITKVIA
HELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFVSLDITYPELHVDDFFLAKCFEAMEVDS
LSSSHPVSTPVENPTQIQEMFDDVSYDKGACILNMLRDFLTPEAFEIGIVRYLKRYSYQN
TVNSHLWESLTNICSSHDLDEGRLKHTEFCSKRKTQSGASKWYSGDELDVRAIMDTWTLQ
EGFPLVTVEVRGREVRLSQERYLKTDDPSPSEGFLWQIPLTYKTSASNTVHRFLLKTKTD
VLFLPEEVDWVKFNVDMSGYYMVHYAGEGWNSIIKLLQHSHTALSGNDRANLIHNVFQLV
SIEKVRLDTALELSLYLSRETKIMAVTQGFGELVPLYKLMEKRDMKVLENQMKSYIVDLF
QDLIDQQEWNDSGSVSQRVLRSYLLLFSCVRNYAPCVTKATQLFNQWKDSDGTMSLPVDI
TMAVFVIGARTPEGWDFLFEKYRHSLQMSVKSRMKTAMAVSPLQDKLKWMMEQSLIGEIM
KTQDLPDVVVSVSKNPHGYQLAWDFLRANWHTMIKKFDLGSSTISYLVTGVTNQYSTREM
LDEVRSFFGSLTEETGSEMRCIQQAYETIEDNIRWMDKNLPLLQAWLDKRNRRVSHEDL
NT seq 2880 nt   +upstreamnt  +downstreamnt
atgatttctgctgaagctgcgtgcaggagacgaagcggtcccgcctctgttgtcaccatg
ttagtggctcctctcctgctagtgctgttcgttcccttttctccctcatctggagcacag
ttaccaaatcaagccaaggccaaagacctccctattgccaccaatggtcagcccttcccc
tgggaccgcatgagacttcccacaaccgtcactccactccactatgacctggccatacac
cccaatctgaccaccctggacttcactggcgttgttcgtattgagcttgatgtgcatgaa
gacaccaacactgtcattctccatgccaagcaaatgcagatatccaatgtgttcctcttg
gcacctgaaggcattaagcgccttaaggtgttggagtatcctcgcttccatcagctagcc
ttgctgtcagactcggtgctcatcaaaggtaggaagtatgaagttcatctggcatttgct
gccaacctgtctgacagtttccatggtttctacaagggaagctaccgcaccagcagcggg
gaggtcagagtcctggcgtccacgcagtttgaagcgacttttgctcgtggagccttcccc
tgttttgacgaacccgccttcaaagccaacttcaccatacgaattattcgagagccacgc
cacatagccatatccaacatgccaatggttaaaactgtggagttgccaggtggtttgctt
gaggatcactttgacaccactgtgaaaatgagcacttacctggttgcctacattgtgtcg
gacttcaagtctgtgagcaagacgacccagcatggtgtcaagatttcaatctatgctgtc
cctgagaagatcgaccagacagcctttgcactggatgctgctgtcaagctgctggacttc
tatgatgactattttgacattccttacccacttcccaaacaggacctggcagctattcct
gacttccagtcaggtgcgatggagaactggggactgaccacctacagagagaccggcctc
ctctttgaccctgaaaagtcatcagcttcagacaagctgggcatcaccaaggtcatcgcc
catgaacttgcgcaccagtggtttggaaacctggtgacgatggagtggtggaatgacttg
tggctcaatgaaggtttcgccaagttcatggagtttgtttctctcgacatcacgtaccca
gaacttcatgtggatgatttcttcctggcaaaatgttttgaggctatggaagtagactcc
ctcagctcttcccacccagtctccacccctgtggaaaatcccacacagatccaggagatg
ttcgacgatgtgtcatatgacaagggtgcatgcattctgaatatgttgcgggacttcctc
actcctgaggcttttgagattggcatcgtccgatacctgaagcgctacagctaccaaaac
actgtgaacagccacctgtgggagagcctgaccaatatctgcagctcacatgatctggat
gaaggtcgcctgaaacacacagaattctgctctaaacgcaaaactcagtccggagcctcg
aagtggtactctggtgatgagctagacgtcagggccatcatggacacctggactctgcag
gaaggcttcccactggtcacggtggaggtcagaggtcgggaggttaggctcagtcaggag
cgttacttgaagacagacgacccctccccgagtgaaggattcctgtggcagatcccgctg
acgtacaagaccagtgcctccaacaccgtccaccgctttctgcttaagacaaagactgat
gtcctgttcctgccagaagaggtagactgggtgaagttcaacgtggacatgagtggttac
tacatggttcattatgcaggcgaggggtggaactctattatcaagctgttgcaacacagt
cacacagccctgagcggtaatgaccgtgccaacctcatccacaatgtcttccagcttgtc
agtatagagaaggtgaggctcgacacggctttggagctgtcgctttacctgtccagagag
accaagatcatggctgtgactcagggctttggagagcttgtgccgctttacaaactgatg
gaaaagagagacatgaaggtgctggagaaccagatgaagagctatattgtagatttgttc
caggatttgattgaccagcaggaatggaatgactccggctccgtgtctcagcgagtgttg
agaagttacctgctgctgttttcctgtgtcaggaactatgctccctgtgtgaccaaagcc
acccagctctttaaccagtggaaggactctgatggcaccatgagccttcctgttgatatc
accatggctgtgtttgtgattggagctcgaacaccagagggctgggatttcctctttgag
aagtaccgccattcgctgcaaatgtcggtcaagagccgcatgaagactgccatggctgtt
agcccactgcaggacaagctcaagtggatgatggagcagagcctcatcggtgagataatg
aagactcaggacctcccagacgtagtcgtctctgtcagcaagaacccccatggctaccag
ctggcctgggacttcctcagagccaactggcacactatgatcaagaagtttgacctcggc
tccagcactatatcatacttggtaactggggtaactaaccagtactctactagagagatg
ctagatgaggtacgaagcttcttcggctccctgacagaggagacgggctcagagatgagg
tgcatccagcaggcctacgagaccattgaggataacatccgctggatggacaaaaatctt
cctcttctgcaggcttggctggacaagcgcaaccgacgagtgtctcatgaggatttatag

DBGET integrated database retrieval system