KEGG   Maylandia zebra (zebra mbuna): 101472881Help
Entry
101472881         CDS       T02814                                 

Gene name
tymp
Definition
(RefSeq) thymidine phosphorylase isoform X1
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00240  Pyrimidine metabolism
mze00983  Drug metabolism - other enzymes
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101472881 (tymp)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101472881 (tymp)
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     101472881 (tymp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C
Motif
Other DBs
NCBI-GeneID: 101472881
NCBI-ProteinID: XP_012778786
Position
LG17
AA seq 430 aa AA seqDB search
MKDHGVDATSQTANIRPADMITIPDLIRKKRDGGQLSDDEIKAFIQAVKEKTIQDSQTGA
MLMAIWLNGMVSAEIKALTREMMSSGEVMEWPDEWKNFMVDKHSTGGVGDKVSLVLAPAL
AACGCKVPMISGRGLAHTGGTLDKLESIPGFKVEQSREQILEILDSVGCCIVGQTETLVP
ADRVLYALRDITSTVDSLPLVTGSIISKKGAESLFALVLDVKFGRAAICKDLESATELAQ
MLVEAGNGLGICTAAVLSGMNSTIGRCVGNSVEVIESLETLKGNRPDDLMELVTTQGGLL
LVMTGLVSDLSEGRKQISEAVVGGAALSKFQAMMEAQGVNSDTAQLLCSTNADYYSILRK
AKHQLELKAPADGIVLEIDGLVLAQVLHRLGAGRSKAGEPVNHSVGAVLLVSIGQRVTKG
KRLLLLLLMV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaccacggggtcgatgccacttcacagactgcaaacatcagaccagcagacatg
ataacaatcccagatctgatcaggaagaagagggatggaggacagttaagtgatgacgag
atcaaagccttcatccaggccgttaaagagaaaaccattcaggactctcagacaggggcc
atgctgatggctatttggctgaatgggatggtctccgccgagattaaggccctgacccga
gagatgatgtcatcgggagaagtgatggaatggcccgatgagtggaaaaatttcatggtg
gacaaacactcgactggcggggtgggagataaagtcagtctggtgttagcgccagcgcta
gctgcctgcggctgtaaggttcctatgatcagtgggcggggcttggctcatacaggagga
actcttgataaactggaatcaattccaggattcaaggtggagcaatcaagagagcagatc
ctggagatcctggactcagtgggctgttgcattgtgggtcagacagagactttggttcct
gcagatcgagtcctgtacgctctgcgggacatcaccagcaccgtggacagtttacctctg
gttactggttcgatcatctcaaagaaaggagccgagtctctgtttgctctggtgctggat
gtcaagtttggacgagctgctatctgcaaagacttggaaagtgctacagaactagctcag
atgctagtggaagcaggaaacggcctgggcatatgtacagcagctgtgctcagcggcatg
aacagtacgatcggtcgatgtgtgggaaacagcgtggaggtgatcgaatctctggagacg
ctgaagggaaacagacccgatgacctgatggagctggtcacgactcagggcggcttgttg
ctcgtgatgactggtctagtgtctgacctatcagaaggcagaaagcagatttccgaagct
gtggttggtggagcagcgctgtcaaagttccaggccatgatggaggctcagggcgtgaac
agcgacacagctcagctgttgtgctccaccaacgcagattactacagcatcctgagaaaa
gcgaagcatcagctggaactgaaggctcctgcagacggtatcgttttggagattgacggt
ttggttttagctcaggtgcttcacagattgggtgcggggcgatcaaaggctggagagcct
gtcaatcacagtgtgggggcggtgctactggtgtctataggtcagagggtcacaaaaggt
aagaggctgttgctactgctgctgatggtgtga

DBGET integrated database retrieval system