KEGG   Maylandia zebra (zebra mbuna): 101473828Help
Entry
101473828         CDS       T02814                                 

Gene name
galc
Definition
(RefSeq) galactocerebrosidase isoform X1
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00600  Sphingolipid metabolism
mze01100  Metabolic pathways
mze04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    101473828 (galc)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101473828 (galc)
Enzymes [BR:mze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     101473828 (galc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M
Motif
Other DBs
NCBI-GeneID: 101473828
NCBI-ProteinID: XP_024662056
Position
LG19
AA seq 665 aa AA seqDB search
MDCRESALLVSVLLLALALCSAQNYVLSDDGGLGRVFDGIGGLSGGGATSRLLVSYAEPY
RSQILDFLFKPNFGASLHILKVEIGGDAQTTDGTEPSHMRYENDENYYRGYEWWLMKEAK
KRNPNITLIGLPWAFPGWVGRGKNWPYDYPDVTATYVVNWILGAKQYHDLDIQYVGIWNE
RSFDIKYIKLLRYTLDKSGLERVKIIASDNLWEPIAFSLLLDPELSTAVDVIGAHYPGTT
TITEALKTQKKLWSSEDYSTFNNEVGGGCWARILNQNYVNGQMTATISWNLVASYYEDLP
FGRDGLMTAEEPWSGNYVVESPIWITAHTTQFTQPGWTYLQTVGHLAQGGSYIALTDGKG
NLTVVIETMTHNHSVCIRPPLPPFNVTSQNATFWLKGSIASIKELQVWRSQFDFKTNKPS
FFEKLKPLKLVDGSFTLNLAEDEVYTLTTVSTGSKGSYPDPPPSARFPKVYKDDFDVRSP
PFSEAPYFADQTGVFEYYINLTDPGPHVFTLRQVLTERPITWATDADQTISVIGDYYWQS
LTVTCDVFMEKMNAGGVFIAARVDKGGQSIRSAKGVFFWVFADGTYKVTNDLVGETVLAE
GQSGTEVHSWYTLSLTVKGQYASGSLNGYPLWKNAVILTPKAGWAAIGTRSFELAQFDNF
ALVAE
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggactgcagagagtcggcgttattagtgtccgttctcctcttggctttggctttgtgc
tctgctcagaattatgtcctgagcgatgacgggggtctgggaagggtttttgatggaatt
ggaggtttaagcggcggaggggcgacgtctcggttactggtgagttatgcggagccgtac
cgcagccagatactagacttcctgtttaagccaaactttggagcttctttgcacattctg
aaggtggagatcggaggagatgcgcaaactactgatggaacagagccgtctcacatgcgc
tatgaaaatgatgagaactactacagaggctacgagtggtggcttatgaaagaggccaag
aagaggaacccaaatatcacactcataggtttgccctgggcgtttcccggttgggtgggc
cgtggcaagaactggccctatgactacccggatgtcactgcaacatatgtggtgaactgg
atccttggtgccaagcagtaccatgacctagacattcagtatgttgggatctggaatgag
cgaagctttgacatcaagtacattaagctgctgcgatacactctggataagagtggtctg
gagagggtcaagatcatagccagtgacaacctgtgggagcccattgccttctctctcctg
ctagaccctgagctgagcacagctgtagacgtgataggggctcactacccgggtaccacc
acaataacagaggccctgaagacacagaagaagctgtggtcgtcagaggactacagcacc
tttaacaatgaggtgggaggaggttgttgggctcgtatcctcaaccagaactatgtcaat
ggacaaatgacagccaccatctcctggaatctggtggccagttattatgaggatctccca
ttcggcagggatgggctcatgacagctgaggagccctggagtggcaactatgtggtcgag
tctccaatttggatcacggcccacaccacacagttcacccagccaggatggacctacctg
cagactgttggacatctggcacaaggtggaagctatattgccttgactgatgggaaggga
aatctcactgttgtcatagaaacaatgactcacaatcattcagtgtgcataagacctcca
ctacctccctttaatgtaacatcccaaaatgcaactttctggctaaaggggtctattgca
tccattaaagagctccaagtgtggcggtcacagtttgactttaagacgaacaagccctcc
ttttttgagaaactaaaacccctgaagcttgtagatggctcgtttaccctgaatctggct
gaagacgaggtttacacactgaccactgttagcacaggaagcaaaggcagctatcccgac
ccacctccctcagctcgctttcctaaagtgtacaaggatgactttgatgttcgaagccca
cctttttcagaagctccatactttgctgatcagacaggagtgtttgagtactacattaac
ctgactgatcctggacctcacgttttcaccttaagacaggttctaacagaaaggcccatc
acatgggcaacggatgctgatcagaccattagtgtcatcggagactattactggcagagc
ctgacagtgacatgtgacgtcttcatggagaagatgaatgctggtggtgtgttcatagca
gccagagtggataaagggggacagtcaatccgcagtgctaaaggagtcttcttctgggtg
tttgctgatggcacctacaaagttaccaatgatcttgttggcgagactgtacttgcagag
ggacagtctggtactgaggtacatagctggtacaccttgtcactcactgtaaaaggacag
tatgcatcagggtcactgaatggataccctctgtggaagaatgctgtgatactgacccca
aaggctggctgggctgccataggaacacgctcatttgaactggcccagtttgataacttt
gctttggtggctgagtga

DBGET integrated database retrieval system