KEGG   Maylandia zebra (zebra mbuna): 101473844Help
Entry
101473844         CDS       T02814                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase isoform X1
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00030  Pentose phosphate pathway
mze00480  Glutathione metabolism
mze01100  Metabolic pathways
mze01200  Carbon metabolism
Module
mze_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mze_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101473844
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101473844
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mze04147]
    101473844
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     101473844
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     101473844
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101473844
  Exosomal proteins of colorectal cancer cells
   101473844
  Exosomal proteins of bladder cancer cells
   101473844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N FlaA
Motif
Other DBs
NCBI-GeneID: 101473844
NCBI-ProteinID: XP_004558775
Position
LG20
AA seq 542 aa AA seqDB search
MTAEMSSVMQPQGNEWSQQTVEEQMGQKMSSESLTRSEVFGQLRRELYGEERSSHSNTHL
FIILGASGDLAKKKIYPTLWWLFRDGLLPDNTFFVGFARSSLTVEDIKAACLPHMKVSDE
ESDYLSAFFSKNSYLSGRYDDGSSFDQLSKHLSSLPGGANANRLFYLALPPTVYHHVSKN
IRTHCMSLKGWNRVIVEKPFGRDLQSSQELSTHLSSLFTENQIYRIDHYLGKEMVQNLMV
LRFGNRIFGPIWNRNSVACVVLTFKEPFGTQGRGGYFDDFGIIRDVMQNHLLQMLCLVAM
EKPPSTSPDDVRDEKVKVLKCIPPVEVSDVVLGQYVGDPEGEGQSRLGYLDDPTVPKDSW
TPTFATAVLHVQNERWDGVPFILRCGKALNERKAEVRLQFTDVPGDIFGDCCQRNELVVR
VQPDEAIYLKMMTKRPGVYFNPEETELDLTYKSRYKDVKLPDAYERLILDVFCGNQMHFV
RSDELREAWRIFTPLLHQVEKEKPRPIPYTYGSRGPREADDLLKSVGFRYEGTYKWVQPH
TA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgacagctgaaatgtcgagtgtcatgcagccacagggaaacgagtggtcacagcagacg
gtcgaagaacagatgggtcagaagatgagctcagagagtctgactcgctctgaggtgttt
gggcagctcaggagggagctttacggggaggagcggtcaagtcattccaatacacactta
ttcatcatactgggagcatctggagatcttgctaaaaagaagatctatccaaccttatgg
tggttattcagagacggccttcttccagacaacacgttttttgtgggttttgctcggtcc
agcttgactgtagaggacatcaaggcagcatgtctgccccacatgaaggtcagtgatgaa
gaaagcgactacctatcagccttcttcagtaaaaactcctacctgagtggcaggtatgat
gacggcagctccttcgaccaactcagcaaacatctgtcatctctccctgggggcgccaac
gctaatagacttttctacctggctctaccaccgactgtctaccatcatgtcagcaaaaac
atcagaacccactgcatgagcctcaaaggttggaacagggtaattgtcgagaagcccttt
ggtcgtgacctccagagttcacaggaactgtcaacccacctgtcgtccctgtttacagag
aaccagatctaccgcatagatcactacctgggaaaagagatggtccaaaacctcatggtg
ctcaggtttggaaatcgcatttttggacccatatggaacaggaacagtgtggcctgtgtg
gttctcaccttcaaggagccttttggcactcagggccgtggaggatactttgatgacttt
ggtattattcgagatgtcatgcagaaccatcttctccagatgctctgtttggttgcaatg
gagaaacctccttctaccagtccagatgatgtgagggatgagaaggtgaaggtgttgaag
tgtatacctcctgttgaagtatcagatgttgtgcttggccagtatgtcggagatcctgaa
ggggaaggtcaatccagactgggataccttgatgatcccacggtgcccaaagactcctgg
acaccaacttttgcaacagcagtcctgcatgtccagaatgagagatgggatggagttcct
tttattctgcgctgtggtaaagcactaaatgagcggaaagcagaagtacgtctgcagttc
actgacgtgccgggagacatttttggtgattgctgtcagaggaatgagctggtggtgcgg
gtgcagccagatgaagccatttacttaaaaatgatgaccaagaggcctggagtttacttc
aatccagaggagactgagctggatctcacctacaagagtcgatacaaggatgtgaagctc
ccagatgcttatgaaagactcatactggatgtcttctgtggaaatcaaatgcattttgtt
cgcagtgatgagttacgggaggcctggaggatcttcacccccctcctccaccaagtagag
aaagagaagccacgccccattccctacacatatggaagtcgtggtccaagagaagcagac
gatctcctgaagagcgtgggatttcgctatgagggaacatacaagtgggtgcagccccac
accgcttaa

DBGET integrated database retrieval system