KEGG   Maylandia zebra (zebra mbuna): 101474525Help
Entry
101474525         CDS       T02814                                 

Gene name
abhd12b
Definition
(RefSeq) protein ABHD12B
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mze01002]
    101474525 (abhd12b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mze04147]
    101474525 (abhd12b)
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101474525 (abhd12b)
Peptidases [BR:mze01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101474525 (abhd12b)
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101474525 (abhd12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S15 Peptidase_S9 Thioesterase DUF1749 Lipase_3 LIP
Motif
Other DBs
NCBI-GeneID: 101474525
NCBI-ProteinID: XP_004540101
Position
LG19
AA seq 324 aa AA seqDB search
MKRAILFLITVYVSVPVILYLFPWILGQVIFAHLLRFPFFVDLSRPEDVLNHTCNFYLNT
EEGISVGVWHTLPASQWEKSARRSPEWYRETLGDGTPVIIYLHGNIGTRAINHRVQLVKI
LSAAGYHVLSLDYRGFGDSTGDPSEAGLTNDALYLYHWVKKHSKGSLVCLWGHSLGSGVA
TNAAVKIQEQESAVDALILEAPYTSIGEVVVNHRFTKMYRFLPGFESLLWNIMKMTNIVF
ANDKNLKSLISPLLILHSEDDNVVPYHMGLELYEISLQTRRKLNTDAHVEMISYSASLGF
SHSSIYLDPNLSGVVRNFLENLRH
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagctattttatttctgataactgtctatgtctcggtgcctgtcattttatac
ctgttcccttggatactgggccaagtcatatttgctcacttgttgaggtttccattcttt
gtggatctcagcagacctgaagatgtcctaaaccacacatgcaatttctacctcaacaca
gaggagggcatctcagtcggagtgtggcatacgctccctgccagccaatgggagaaatcc
gccaggagaagccctgagtggtaccgggagactctgggagacggcactcctgttattatc
tatctccacggcaacatagggaccagggcaataaatcacagagtacaactggtgaagatc
ttaagtgctgcggggtaccatgtcttatctttagactacagaggttttggagattctact
ggggaccccagtgaagctggattgaccaatgacgccctctacctgtaccactgggtaaag
aaacacagcaaggggagtctcgtctgtctgtggggacactcgcttggctccggggtggca
accaatgcagcagtgaaaatacaggagcaagagtctgctgttgatgctttgatccttgaa
gctccatacacaagcatcggagaagtcgtagtcaaccatcggttcacgaagatgtacagg
ttccttccaggatttgagagcttgctgtggaacataatgaaaatgaccaacatagtattt
gctaatgataaaaacttgaagtccctgatcagtccacttcttattctgcattcagaggat
gataatgttgttccttatcacatgggcctggagctgtacgagatatcactccagactcgg
aggaaattaaacaccgatgcacacgtcgaaatgatctcctacagtgcaagtcttggattc
tcccacagcagcatctacttggatcccaatttatcaggtgtggttaggaactttctagaa
aacctgagacactag

DBGET integrated database retrieval system