KEGG   Maylandia zebra (zebra mbuna): 101474602Help
Entry
101474602         CDS       T02814                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 14
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04060  Cytokine-cytokine receptor interaction
mze04068  FoxO signaling pathway
mze04210  Apoptosis
mze04217  Necroptosis
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101474602
   04068 FoxO signaling pathway
    101474602
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101474602
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101474602
   04217 Necroptosis
    101474602
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101474602
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mze04147]
    101474602
   04052 Cytokines and growth factors [BR:mze04052]
    101474602
   04090 CD molecules [BR:mze04090]
    101474602
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101474602
Cytokines and growth factors [BR:mze04052]
 Cytokines
  Tumor necrosis fators
   101474602
CD molecules [BR:mze04090]
 Proteins
  101474602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF Pilin_GH
Motif
Other DBs
NCBI-GeneID: 101474602
NCBI-ProteinID: XP_004559600
UniProt: A0A3P9C8V0
Position
LG4
AA seq 228 aa AA seqDB search
MEKIKYPSVCVVDTHATRPPVPPRLIQMRKKTGVAQILLFMLVSVALCGMVIEACFIYGL
YQAEHTDSESISKLIRVTTATEQPSYAIPPSKPVAHLTDGQDVAHAKNKMAWSMNADPLL
YEMTYKDRELKIEKEGYYYVYSKVFFSDSNGFQHRISMHTDRYSGNITLLQSRKYPSHSK
VSQKTQSNSYLGGVFHLYKDDGIFVDVSDTAKIVRHKPSENVFGAYMI
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggagaagattaaatatccctctgtgtgtgtggtggacacccatgccacaaggcctcca
gtgccccccaggctgatccagatgcgaaaaaagaccggggtggctcagatcctgctcttc
atgctggtgagcgtggcgctgtgcggcatggtcatagaagcatgcttcatctatggactc
taccaggccgaacataccgactcagaatcgatctctaagctcatcagagttacaactgcc
actgaacaacccagttatgctattcctccctccaaaccggttgcacatctgacagatgga
caagatgtagctcatgcaaaaaacaaaatggcatggagcatgaatgcagaccctctcctc
tatgaaatgacctacaaagacagagagcttaaaattgagaaagagggttattactatgtc
tattccaaggttttcttctcagacagcaacggatttcagcaccgtattagcatgcatact
gacaggtattcagggaatatcaccctcctgcagtccaggaaatatccttcacattcaaaa
gtcagtcaaaaaacacaatccaacagttacctgggtggagtgtttcacctttataaggat
gatggtatttttgtggacgtgagtgacactgcaaaaattgtacgccacaaaccctctgag
aatgtctttggtgcctatatgatatag

DBGET integrated database retrieval system