KEGG   Maylandia zebra (zebra mbuna): 101474920Help
Entry
101474920         CDS       T02814                                 

Definition
(RefSeq) cAMP-responsive element modulator isoform X1
  KO
K09052  cAMP response element modulator
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mze00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101474920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mze03000]
    101474920
Transcription factors [BR:mze03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101474920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 101474920
NCBI-ProteinID: XP_004568562
Position
LG9
AA seq 207 aa AA seqDB search
MNQMKTDEKYQLPVDQQKSCKQNNGLFQRVPATIMPNKVENLPSMAMTRTQALQYPLSTS
LQCCGGIQNWALHPYTAYSLPGTPVNFQIRSQMLASIATASTCTPSPPPETCTPGDLTGC
QLRNPTSSLPQGVAGPSAHSSQKLIEDALQKRELRLMKNREAARECRRKKKEYVRCLENR
VAVLENQNKTLIEELRALKDIYRHKVE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaatgaagacagatgagaaatatcagctgcctgttgaccagcaaaagagctgc
aaacagaacaatgggctttttcaaagagttcctgccacgataatgcctaataaggtagag
aacctgccatcgatggctatgactaggacacaagcactccagtatccattaagcacttct
cttcagtgctgtggagggatccagaattgggcactgcacccctatactgcgtattcctta
ccaggcactccggtcaacttccaaatccgttcacagatgctggcatcaattgccacggcc
agcacatgcacaccaagtcctccaccagaaacctgtacccctggtgacctgactggctgc
cagctgcgtaaccccacctccagcctccctcagggtgtcgcagggcccagtgctcacagc
tcccagaaacttatagaggatgccttacagaagagggagctgcgcttgatgaagaacagg
gaagctgcccgtgagtgtcggcggaagaagaaggaatatgtcaggtgccttgagaatcgc
gtggccgtgctggagaatcaaaataagactctgatagaagagcttagagccttaaaagac
atctatcgtcacaaagtggagtga

DBGET integrated database retrieval system