KEGG   Maylandia zebra (zebra mbuna): 101474943Help
Entry
101474943         CDS       T02814                                 

Gene name
ppox
Definition
(RefSeq) protoporphyrinogen oxidase isoform X1
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00860  Porphyrin and chlorophyll metabolism
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101474943 (ppox)
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     101474943 (ppox)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     101474943 (ppox)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Thi4 Pyr_redox_2 FAD_binding_2 MCRA
Motif
Other DBs
NCBI-GeneID: 101474943
NCBI-ProteinID: XP_024659936
Position
LG11
AA seq 476 aa AA seqDB search
MRTVAVLGGGIGGLAASYYLCKSPQVTKVILLEASSRFGGWLWSTRRSDGAVFEHGPRGI
RPAGAVGSNTLNMVDDLGLGEEILPVSYSHVASRNRYLYVNGQLHKMPSGISGIVRTVPP
FSQPLLLSVAAEILVNKTKNDDESVHSFVSRRLGKELADIAVDSLCRGVFAGDCRKLSVR
SCFPVLYNAEQHRGSIVLGMLLGSGEAQVITRGPLAKRSKKESWAQWSLKRGMQSFPEAI
AENLQQSGRVQLHKEAVVKQIDPSASGWQVRLEDGVLSADHIISALPAKALSSVLPRSCQ
PLTQQLQDISSVTVAVVNLEYDGSILPVMGFGHLVPSSEDRGLLGVVYDSVPFPQHNRPD
GQTTRLTVMMGGAWFEEEFGVPEAATAERLLSRATEAVRCHLGVTAAPSWSRVILHRDCI
PQYYEGHFQRVESMRGFIKNNNLALSLTGSCYDGVSVNDVIFSGRTAVEELLGTVV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagtcgctgtccttggaggagggattgggggtttggctgcatcctactacctg
tgcaagagcccccaggttaccaaggtcatccttctagaggcaagcagtcgttttggaggt
tggctgtggtccactcggagatcagatggagcagtgtttgaacatggacccagagggatt
cgacctgcaggggcggtgggctccaacacgctcaatatggtggatgatttgggtcttgga
gaggagatcctgccggtcagctacagccacgttgcctccagaaacagatacctgtatgtt
aatggtcagctgcacaagatgccgtcaggaatcagtgggattgtgcggacagtcccaccg
ttctctcagccgctgctgctgagcgtcgctgctgagatcctggtgaataaaaccaagaac
gacgacgagtcagtccattcgttcgtttcgaggaggctaggaaaggagttagcagacata
gctgtggacagcttgtgtcggggtgtatttgcaggggactgcaggaagttgagtgtgcgc
tcttgttttcctgtcctctacaacgcagagcagcacagaggttccatcgtcctgggaatg
ctgctgggctcaggtgaggctcaggtgattacccgcggccctctggctaaaagatctaag
aaggagtcgtgggcacagtggtcgttgaagaggggcatgcagtcgtttccagaagccatt
gcagagaacctacaacagagtgggagagtgcaacttcacaaagaggctgttgttaagcag
attgatccttcagcctctggttggcaggtccgtttggaggatggagtcctatcagccgac
cacatcatctctgcactgcctgctaaagctctttcttcagtgctgccccgctcctgccaa
cctcttacccagcagctgcaggacatctcctcagtaacagtagctgtggtcaatctggag
tatgacggctccatcttgcctgtaatgggttttggtcacctcgtcccgtcatcggaggac
cgagggttgctcggggtggtctatgactctgttcccttccctcagcacaacagaccagat
ggacagactactagactgacggtaatgatgggcggggcttggttcgaggaggagtttggg
gttccagaagcagcaacagcggagcgtctcttatcaagagccactgaggcggtgcgctgc
cacctcggagtcactgcggcacccagctggagtcgagtgattctgcacagggactgcata
cctcagtactatgaaggacactttcagagagttgagtccatgcgtggcttcataaagaac
aataacctagccctgtccttgactggttcctgttacgatggtgtgtcagtgaatgatgtc
atcttcagtggacggacagctgtggaggagttgttgggaactgtagtatga

DBGET integrated database retrieval system