KEGG   Maylandia zebra (zebra mbuna): 101475256Help
Entry
101475256         CDS       T02814                                 

Definition
(RefSeq) glutamate dehydrogenase, mitochondrial
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00220  Arginine biosynthesis
mze00250  Alanine, aspartate and glutamate metabolism
mze00471  D-Glutamine and D-glutamate metabolism
mze00910  Nitrogen metabolism
mze01100  Metabolic pathways
mze01200  Carbon metabolism
mze04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    101475256
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101475256
   00220 Arginine biosynthesis
    101475256
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101475256
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    101475256
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     101475256
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101475256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELFV_dehydrog_N ELFV_dehydrog 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 101475256
NCBI-ProteinID: XP_014269264
Position
LG13
AA seq 546 aa AA seqDB search
MYRYFGELLTRGAGGVLASGYPAAAADSVLPASASLLRHRGYSQAVDPADDPNFFTMVEG
FFDKGAAIVEDKLVEDLKTRETAEQKRSRVRGILRIIKPCNHVLSVSFPIKRDSGEWEVI
EGYRAQHSQHRTPCKGGIRYSTEVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKK
YSDNELEKITRRFTIELTKKGFIGPGIDVPAPDMSTGEREMSWIADTFATVMGHNDINAH
ACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSQLGMYPGFQDKTFVIQGFGNV
GLHSMRYLHRFGARCVGVGELDGSIWNPEGINPKELEDYKLANGTIVGFPDSTPYEGSIL
EADCDILIPAASEKQLTKSNAHKIKAKIIAEGANGPTTPEADQIFLERNILVIPDMYLNA
GGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGSVPVVPTSE
FQARIAGASEKDIVHSGLAYTMERSARQIMRTANKYDLGLDLRTAAYVNAIEKVFKVYSE
AGLIIT
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtaccggtacttcggagagctactcacccggggagcgggcggcgtcctggcctcgggg
taccccgccgccgctgctgactctgttctgccggcgtccgcgtccctgctgcggcaccgc
ggctacagccaggccgtagatccggccgacgacccgaacttcttcactatggtagagggc
ttcttcgataagggcgccgctatcgtggaggacaagctggtggaagacctgaagactcga
gagactgccgagcagaagaggagccgggtccgcgggatcctgcggatcatcaagccgtgc
aaccacgtcctgagcgtcagcttccccatcaagagagacagcggggagtgggaggtgatc
gagggctaccgggctcagcacagccagcaccggacgccctgcaagggaggtatccgttac
agcacagaggtgtctgtggacgaggtgaaagctctggcctcgctgatgacctacaaatgt
gccgtcgtagatgtgccttttggtggagccaaagccggcgtgaagatcaacccgaagaag
tactcggacaacgagctggagaagataacccgaaggtttaccatcgagctcaccaagaag
ggcttcatcgggcccggcatcgacgttcctgctccggatatgagcaccggggagcgcgag
atgtcctggatcgccgacaccttcgccaccgtcatgggacacaatgacatcaacgcccac
gcctgcgtcaccgggaagcccatcagtcagggaggaattcacggccgcatctccgccacc
ggccggggagtcttccacggcatcgagaacttcatcaacgaggcgtcatacatgagccag
ctcgggatgtaccccgggttccaggacaagaccttcgtcatccagggcttcggtaacgtg
gggcttcacagcatgcgctaccttcaccgctttggagcgaggtgcgtcggagtcggagaa
ttggacggaagcatctggaaccccgaaggcatcaaccccaaagagctggaggactacaaa
ctggccaacgggaccatcgtgggtttcccggactcgacgccatacgaaggaagcatcctc
gaggccgactgcgacatcctgatccccgccgccagtgagaaacagctgaccaaaagcaac
gcccacaagatcaaggccaagatcatcgcagagggagccaacgggccgactacacctgaa
gctgaccagatcttcctggagagaaacatcctggtgatcccggacatgtacctgaacgct
ggcggtgtgacggtttcctacttcgagtggttgaagaacctgaaccacgtcagttacggg
cgactcaccttcaaatacgagcgagactccaactatcacctgctgatgtcggtccaggag
agtctggagaggaagttcggcaaacacggcggctccgtccccgtcgtccccacctctgag
ttccaggctcggatcgccggagcgtctgagaaggacatcgttcactcgggtctggcctac
accatggagcgctctgcccggcaaatcatgagaaccgccaacaagtacgacctgggtttg
gacctgcggacggcggcgtacgtcaacgccatcgagaaggtgttcaaggtttacagcgag
gccggcctcatcatcacatag

DBGET integrated database retrieval system