KEGG   Maylandia zebra (zebra mbuna): 101476887Help
Entry
101476887         CDS       T02814                                 

Gene name
map4k4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101476887 (map4k4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101476887 (map4k4)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101476887 (map4k4)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  STE20 family
   101476887 (map4k4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 101476887
NCBI-ProteinID: XP_004573642
Position
LG23
AA seq 1505 aa AA seqDB search
MANDSPAKSLVDIDLASLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNQLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIESCLVKNYTQRPPTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTKKKRGEKDETEYEYSGSEEEEEDPPEQEGEPSSIVNVPGESTLRRDFIRLQ
QENKERSEALRHQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREMR
RQQEREQRRREQEEKRRMEEMDRRRKEEEERRQDEKRRNDREQEYIRRQLEEEQRHLEML
QEQLLREQAMLLEFKWRELEEQRKAERLHKRLQQEQAYLLSLQHDSKQQPGDKTKLPSDH
SKPPQAATLPPDRALATLPQAQVLNSAVSVARGACESSRAPQTIPADSSKSQATGQERTD
ESLSRVSNSPSSLQTETPSDSNPPQTESSEPDSEPVSQPPQPIREADERYRKNIQGSPQA
APPPKQPPLPPRSSEPFSNGGSSSDASAMHRPMEPQVQWSHLAALKSSNSAAPSPPPPPV
VARSQSFSESGGVASSFAQLHLRSQDPHHHHHHHPSPARTDPQPQPPLHHPQARLEHQAS
SEEVPPKVPVRTTSRSPVLSRRESPLPSQPSNQGGQRNAGSNVEQRPLWDRVEKLQSRPG
SGSSSGSSNSSSQASPGDRFRPRCESPASSKSEGSPLQRPENVSKKQDEKNVARPTRPAD
LTALAKELRAVDDVRPPHKVTDYSSSSDESGTTDEEDEEEVDQEAGEESTSGAEDSKAGY
PHGFRRRVSNGETESAKTMLVEDSESEQATTPSKDGTLVIRQSTADIKRLVTLSSSSPSS
AGHGQPQPPGRGPLEKNGFPGRIHHLPDLIQQSHHSTSSSTTIPSFSSSSSSSTTTTSSS
LPSSSSHASPAVSPQISLDELTAIESQSESNSMSKHKSSSSFTPFIDPRLLQISPSSGSS
LNNMAGFGQDGRLSDQLRSDPSRKGSVVNVNPVNTRPPSDTPEIRKYKKRFNSEILCAAL
WGVNLLVGTESGLMLLDRSGQGKVYPLINRRRIQQMDVLEGLNVLVTISGKKNKLRVYYL
SWLRNKILHNDPEVEKKQGWVNVGDLEGCVHYKVVKYERIKFLVLALKNSVEVYAWAPKP
YHKFMAFKSFGDLVHKPLLVDLTVEEGQRLKVIYGSCSGFHAVDVDSGAVYDIYLPTHIQ
TNIQCHAIIILPNTDGIELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQIM
GWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRAGGASQVYFMTLGRT
SLMSW
NT seq 4518 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactctccagctaaaagtctagtagacatagacttggcttcattgcgggat
ccagctgggatattcgagctggtggaggtagttggaaatggcacctatggacaagtatac
aagggacgacatgtcaagactggacagctggctgccatcaaggtcatggatgtcacagag
gatgaagaagaggaaattaaactggagatcaatatgctgaagaagtattcccaccacaga
aacatagccacctactatggtgctttcattaagaagagccctccaggacacgatgaccag
ctatggttggtgatggagttctgtggtgctggttccatcacagacctagtgaagaacaca
aaggggaaccagctgaaggaagactggattgcctacatctccagagagatcctcagaggt
ctcgcccacttacacgcccaccacgtcatccaccgtgacatcaaaggccagaacgtgtta
ttgacggagaatgctgaagttaaactagtggattttggcgtgagtgctcagctggatcgg
acagttggaaggagaaacaccttcattgggacaccttactggatggccccagaagtcatc
gcttgtgacgagaacccagatgcaacatatgattaccgaagtgatctgtggtcctgcggt
atcacggctattgaaatggctgaaggagcgccccctctttgcgacatgcaccccatgcgt
gcactcttcctcattccaagaaatcctcctcctcggctgaaatctaaaaaatggtccaaa
aagttcttcagtttcatcgagagctgcctcgtgaagaattacacgcagcgcccaccaaca
gagcagctgctgaagcaccccttcatccgagaccagcccaacgagcggcaggtccgcata
cagctcaaagaccacatcgaccggacgaagaaaaagaggggcgagaaagatgagacggaa
tatgagtacagtggcagtgaggaggaggaagaggatcctcctgagcaagaaggagagccc
agctcaattgtcaacgtgccaggtgaatctactctacggcgtgacttcatccgcctgcag
caggagaacaaggagaggtcggaggcgctccgtcaccagcagctcctccaggagcagcaa
ctccgggagcaagaggagtacaagcgccaactactggcagagaggcagaaacgtatcgag
caacagaaggagcagagaaggcggttagaggagcaacagcgacgcgaacgggagatgagg
aggcaacaggagcgcgagcagcgtcgtcgcgagcaagaagaaaagaggcgtatggaggag
atggatcgtagacgtaaagaggaggaggaacgccggcaggacgagaagagaaggaacgat
cgtgagcaggagtacatcaggcgccagctggaagaggagcagagacacctcgagatgctc
caggagcagctgctccgtgagcaggccatgctgctggagttcaagtggcgggagctcgag
gagcagcgcaaagccgagcgtctccacaagcgcctgcagcaggagcaggcgtacctgctg
tccctgcagcacgactccaagcagcaacctggcgacaaaacaaaactcccatcagaccat
agtaagccgccacaggctgccactctgccccctgacagagccctcgccacactcccacaa
gctcaggtcctcaactctgccgtctctgtagcgaggggcgcctgtgaatcctccagagcc
cctcagacgatccctgcagacagcagtaaatcccaggcaacagggcaggagaggactgat
gagagtttgagccgggtctcaaactcccccagctcccttcagactgaaaccccctctgac
tctaaccctcctcagacagaaagctcggagcccgacagcgagcctgtcagtcaacctcct
cagcctatcagagaggccgacgagcgctaccgtaagaacattcagggctcccctcaggcc
gcccctcctcccaagcagccccctctgcctccccgctcctctgaaccattctccaacggc
ggctcttcgtccgacgcatctgccatgcaccgacccatggagcctcaggtccagtggtct
cacctggctgctctaaagagcagcaacagcgctgccccctctcctcctcctccacccgtg
gttgcccgctctcagtccttcagcgagtccggcggtgtggcctctagctttgcacaactc
cacctgcgctcccaggacccccaccatcaccaccaccaccacccatcgcctgcacgcaca
gatccccaaccccaacctcccctccaccaccctcaggctaggcttgaacatcaggccagc
agcgaggaggtccctcccaaggtaccggtgaggacaacatccaggtctcctgtactgtca
cgtagagagtcccctctgccttcacagcccagcaatcagggcggacagaggaacgcaggc
agtaacgtggagcagcgtccgctgtgggatcgagtggagaagctgcagtcccggccaggc
agcggcagctcgtccggctcctccaactccagctcccaggccagtcctggggaccgtttc
aggccacgctgtgagtcccctgcttcctccaaatctgaaggatcgcctctccagcggcct
gaaaacgtttccaagaaacaggatgaaaagaacgtcgccaggcccactcgaccagctgac
ctgacagcgctcgccaaggagctgcgcgcagtcgacgatgtgcgacctcctcacaaggtc
acagactactcctcctccagtgacgagtcgggcacgaccgacgaggaggacgaggaagag
gtggaccaggaggcaggagaagagtccacctcaggggccgaggactccaaagctggatat
ccccatggcttccgcaggagagtgagtaacggcgagacggagtctgctaaaaccatgctg
gtcgaagactcggaaagcgaacaggcaaccacaccctccaaggatggcacactggtcatc
agacagagcacagctgacataaagcggttggtcactctctcatcttcctccccttcctcg
gctggccacggccaaccccaaccccctggtcgcggcccgctagagaaaaacggctttccg
ggccgcatacaccacctaccagaccttatccagcagagccatcattccacttcctcttcc
acaaccatcccttccttctcctcctcctcctcctcttccaccaccactacctcctcctcc
ttaccctcatcatctagccatgccagtcctgcagtatccccacagatctctttggacgag
ctcactgccatagagtcgcagtcggagagcaactccatgtccaaacacaagtcttcctcc
tcgttcactcccttcatcgacccgcgtctgctgcagatatctccatccagcgggagctcc
ctcaacaacatggctggatttgggcaagacgggcgcctgtcagatcagctgcggtccgac
ccatcccgtaaaggctcggtggttaatgtcaacccggtcaacactcgtccaccgagcgac
accccggagattcgcaagtacaagaagaggttcaactctgagatcctgtgtgcggcactc
tggggagtaaatctgctggtgggaacagagagcggtctgatgctgctggaccgaagcggt
caaggtaaggtctaccctctgatcaaccgtcgacgcatccagcagatggacgtcctagag
ggactcaacgtcctggtgaccatatcaggcaaaaagaacaagctgcgagtgtattacctg
tcatggcttcgaaacaagattttgcacaatgaccctgaggtggagaagaagcaggggtgg
gtcaatgtgggcgacctggagggctgtgtccactacaaagttgtgaagtacgagagaatt
aaattcttggtgctggctttgaagaactctgtggaggtctatgcgtgggcgcccaaacct
tatcacaagttcatggcctttaagtcttttggtgacctggtgcacaaacctctgctggtt
gacttgacggtggaggaaggtcagaggttaaaggtcatctacggttcctgttcaggcttc
cacgctgtggatgtggactctggtgccgtctacgacatctacctgcccacacatatccaa
accaatattcagtgccacgccatcatcatcttgcccaacactgatgggattgagctgctg
gtgtgttacgaggacgagggcgtctacgtcaacacctacggacgcatcaccaaagatgtg
gtgctgcagtggggagaaatgccaacttcagtggcctacattaggtcaaaccagatcatg
ggctggggtgagaaggctatagagatccgctcagtggagacgggccaccttgacggagtc
ttcatgcacaagagagcccagagactcaagttcctttgtgagaggaatgacaaggtcttc
tttgcctctgtgcgtgccggaggtgccagccaagtatatttcatgaccctgggacgcaca
tccctcatgagctggtag

DBGET integrated database retrieval system