KEGG   Maylandia zebra (zebra mbuna): 101476960Help
Entry
101476960         CDS       T02814                                 

Definition
(RefSeq) activin receptor type-1B
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04060  Cytokine-cytokine receptor interaction
mze04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101476960
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101476960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101476960
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101476960
Protein kinases [BR:mze01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   101476960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101476960
NCBI-ProteinID: XP_004544950
UniProt: A0A3P9BP26
Position
LG5
AA seq 500 aa AA seqDB search
MADLRMSLAVLVVHTVLYTACQALWCNCTTPLCKKSDFQCETDGACTASTIFSNGKQQHS
RGCIPQEDLVPPGKPIYCLGVEGYLYTQCCYTDYCNSIDLRVPTEIGGGYGPGGTWRLVE
LVAVIAGPLFLLCLLLLVGAFIYHYHRRGYNHRQRLEVEDPSCDHLYLAKDRSLEDLLCN
LSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWF
REAEIYQTIMLRHENILGFIAADNKDNGTWTQLWLVSDYHEYGSLFDYLNRYSVTTEETI
KLALSAANGLAHLHMEILGTQGKPGISHRDLKSKNILVKKNCTCAIADLGLAVRHDSATD
TIDIAPNQRVGTNRYMAPEVLDETINTRHFESFKCADIYALGLVYWEIARRCNSGGIHQE
YQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQNYEALRIMGKIMRECWYANGAARL
TALRIKKTLSQLSIQEDIKI
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggctgacctacggatgtcactcgctgtcctggttgttcacactgtcctatacacagcc
tgccaggctctgtggtgtaactgcaccactcctctgtgtaagaagtctgacttccagtgt
gagaccgatggggcctgcacggcttccaccatcttcagcaatggaaaacagcagcacagc
cgcggctgtatcccacaggaagatctcgtgccccctggaaaaccgatctactgcctcggt
gtagaaggctacctatacacgcagtgctgctacaccgactactgcaacagcattgacctc
agagtacccactgaaatcgggggaggctacggcccgggtgggacatggaggctcgtggaa
ctggttgctgtgatcgcagggccgctgttcctgctgtgtctgctactgttggtgggtgcg
ttcatatatcattatcaccggaggggctacaaccacaggcaaaggctggaggtggaggat
ccgtcctgtgaccatctctacctggccaaagacagatccctggaggatctcctttgcaat
ctatccacgtctggttcaggctctggtctccctctctttgtccagcggactgtagccaga
acaatcgtcctgcaggagatcattggtaaggggcgtttcggggaggtgtggcgaggacgc
tggaggggtggcgacgtggctgtgaagattttctcatccagggaagagcgctcctggttc
cgtgaggctgaaatctaccagacgatcatgcttcgccatgaaaacatcttgggctttata
gctgctgacaacaaagacaacgggacgtggactcagctgtggttggtgtcagattaccac
gagtacggctctctgtttgactacctaaaccgctactccgtcactaccgaggaaacgatc
aaactggcactatcagctgcgaacggcctcgcacatctgcacatggagattcttggaacg
caaggaaagccaggcatctcccatagagacttgaagtccaagaacatcctggtgaagaag
aactgcacctgtgccattgccgacctgggcttggctgtccgtcacgactctgccacggat
acgatcgacatcgcgcccaatcagagagtgggaaccaacaggtacatggccccagaggtt
ctcgatgagaccataaacacaagacacttcgaatcattcaaatgtgctgacatctacgct
ttaggcctggtctactgggaaattgcacgccgctgtaacagtggaggtatccatcaagaa
taccagctgccctactatgatctggtaccgtctgacccgtccatagaggagatgagaaaa
gtggtgtgtgaccaaaagcttcgacccaatattccaaattggtggcagaattacgaggcc
ttgcggatcatgggtaaaatcatgagggagtgttggtatgctaacggagctgcacgcctg
acggccttgcgcataaaaaagacgctgtcccagctcagcattcaggaggacattaaaatc
tga

DBGET integrated database retrieval system