KEGG   Maylandia zebra (zebra mbuna): 101477282
Entry
101477282         CDS       T02814                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mze03000]
    101477282 (ahrr)
Transcription factors [BR:mze03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101477282 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4 RLL
Other DBs
NCBI-GeneID: 101477282
NCBI-ProteinID: XP_004575861
UniProt: A0A3P9DFI7
Position
Unknown
AA seq 694 aa
MIPPGDCMYAGRKRRKPIQKQKPSSANEKTNPSKRHRDRLNAELDRLASLLPFPPDVISK
LDKLSVLRLAVSYLRVKSFFQASQDKTSRKHIMSTASSNPEPRKESLPLGTGVNESSLLL
ESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAMC
PPQHQGTVAHQDNQLAAGTGEDFVVSSLFHSPEAGEIPPELSCFLNRCFIARVRCLLDST
SGFLTMQFQGRLKFLHGQKKKSASGAPVAPQLALFCIAVPLLLPSITEMKMKNMLMRGKN
KGAVGGIISGLEQGERGEHLRRHSFNGGMGDAADSLRLSCPTPGATQRGHHTPWTPLSKD
NLKFRPDGYYNQEEPLNYCKSSVGPHKGLSPGVGGGWPPRQNSGPVRAGQGVSYIPSNRM
NKTGQYGKPYRLSPSCHSGRGGEVFVSKLYGNVQIPTDPDAYCVDLVKSENGYGECFDGH
LMPEMPPIKIEHDSDSENGCDAYGRPWTCRDQVPVDRRYGNGLYDHTVGLQLKSEADYYD
PQYSPCQRGKAGISPPYNNGNYQNYAVNNGNANARLLKCDKDLGSNNDSSQFSPQRFPHS
DSLCSSQSVNLMDSHVYSQDPHKAYMQSDYNKHGTYEFKGHSLIHSIKREPIDSPPWPES
GHDMNQSIMVGSRNVMPCVMSTGHHKSSPYIYMP
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgatccctcctggagactgcatgtatgcgggcagaaagaggaggaagcccatccagaaa
cagaagccatcctctgccaatgagaaaaccaacccatccaagcggcaccgggacaggctg
aatgctgaactggaccgcctggccagcctgctgccattccccccagatgtcatctccaag
ctggacaagctgtcagtgctccgtcttgctgtttcctacctccgcgtcaagagtttcttc
caagcgagccaagacaagaccagcaggaagcacatcatgagcacagcatcctctaaccct
gaacccaggaaagagagccttccactgggcacaggcgtgaatgaaagcagcctcctcctg
gaatctctgacaggctttgccttggtggtgagcagtgacgggatggttttttacgcttcc
tcgaccattgtggactatctgggatttcatcagactgacgtgatgcaccagaatgtgttt
gactacatccacatagacgaccgtcaggaattcagacgccagctccactgggccatgtgt
cctccacagcaccaagggacggtggcacaccaggataaccagctagctgcaggaactggt
gaagactttgtagtgagcagcctgttccattctccagaggcaggggaaatccctcccgag
ctctcctgctttctcaacagatgtttcatagccagagtccgatgccttttggacagcacc
tctggattcttgacgatgcagttccaaggtcggttgaagttcctccatgggcagaaaaag
aagtcagcctctggtgctccagtggccccacagctggctttgttctgcatagctgttccc
ctcctgctcccctccatcacggagatgaaaatgaagaacatgttaatgcggggaaagaat
aaaggagcagtaggaggaatcatctccggactggagcaaggcgagcgtggagaacacctc
cggagacactccttcaatggaggaatgggtgatgctgcagattctctccggctctcctgt
cccactcctggtgcaacccagcgaggtcaccacactccgtggaccccactctccaaagac
aacctcaagttccgcccggacggttactataaccaggaggagcccctaaactactgcaag
tcctccgtgggtccccataaaggtctgagcccaggcgtgggtggcggctggcctccgcga
cagaactcaggacccgtcagggcaggccagggcgtcagctacatcccctctaaccgcatg
aacaagaccggccagtacgggaagccgtaccgtctctcgcccagctgtcacagcggcaga
ggtggtgaggtgtttgtctccaagctgtacggcaacgtccagattcccacagacccagac
gcctactgcgtggacctggtgaagagcgagaatggctacggagaatgcttcgacggtcac
ctgatgcccgagatgccccccataaagatcgagcacgactctgattcggagaacggctgc
gacgcgtacggccgaccctggacgtgccgcgaccaagtgcccgttgaccgtcgctatggt
aacggcctatatgaccacaccgttggcctgcagctgaaatccgaagctgattattacgat
ccacagtattcgccctgccagcgggggaaggctgggatcagcccgccgtacaacaacggt
aactatcagaactatgcagtgaacaacgggaacgccaacgcacgcctgttaaagtgcgac
aaagacctgggcagtaacaatgactccagtcagtttagtcctcagagattcccacactca
gactctctatgcagcagccaatccgtcaacctcatggactcgcacgtctactcacaggat
ccacacaaggcctacatgcagtctgactacaacaagcatggcacctacgagttcaaaggt
cacagcctgatccattcgatcaagcgggagcccatagactcgccgccgtggcctgagagc
ggccatgacatgaaccagtccataatggtcggctccaggaacgttatgccatgcgtgatg
agcacaggacaccacaagtccagtccatatatttacatgccgtga

DBGET integrated database retrieval system