KEGG   Maylandia zebra (zebra mbuna): 101478985Help
Entry
101478985         CDS       T02814                                 

Definition
(RefSeq) glutathione hydrolase 5 proenzyme-like
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00430  Taurine and hypotaurine metabolism
mze00480  Glutathione metabolism
mze00590  Arachidonic acid metabolism
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101478985
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    101478985
   00480 Glutathione metabolism
    101478985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mze01002]
    101478985
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mze04090]
    101478985
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     101478985
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     101478985
    3.4.19.14  leukotriene-C4 hydrolase
     101478985
Peptidases and inhibitors [BR:mze01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   101478985
CD molecules [BR:mze04090]
 Proteins
  101478985
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept LapA_dom
Motif
Other DBs
NCBI-GeneID: 101478985
NCBI-ProteinID: XP_024656945
Position
Unknown
AA seq 580 aa AA seqDB search
MCPPNEDVKDKDVESAKTTCTCPPKVHPLLVVGAVCLIVGALVVGLPAFILYLKGKSECV
KEPSADCPFSKAAVAADSEKCSRIGRDILRKGGSAVDAAIAALLCTSIINPQCAGIGGGV
IFTVMDSSGKVKIINSRETVPRNVNPDLLKLCRKTTEQTTEWLQDSRWIGVPGEIRGYEA
AHRLYGKLPWADLFQPTIKLAREGFPIPYYQGQHIPRINNTSIRKLYLDKNGNLLKTGDT
VKFEKLADTLEMIANEGPDVFYNGTIAKNLISDIQDAGGKLTLEDLALYQANVTDAWNIS
LEEYRMYFPPPPAGGAILSLILNIMKGYKMNSEPKTTDEKILFYHRYIEALKFANGLKKH
IRDPNFSSDKMAKNLTEDSFANHIRSLISSDKTHDPQYYGKNSYLDSIGTTHVSVLAEDG
SAVSVTSSINDEFGSNVLSSSTGIILNNHLNDFCGRADNIFHGERPPSNMAPSVLKSPSK
TLVIGGSGAEMIPPAVASALMNHLWFRKSLKEAIDTLVVLVDSKSEVKPEPKLEKDVVDG
LEAKGHKIAKFYNTVNAVEKAGSCISAWSDERKKGKAAGY
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtgtccccccaacgaggacgttaaggacaaggatgttgagagcgcaaaaacgacttgt
acttgcccgcccaaagttcaccccctattagttgtaggtgcagtttgtctaattgtaggt
gctctagtagttggtctaccagcttttatcctttatttgaagggtaaaagtgagtgtgtc
aaggaacccagtgctgattgccctttttcaaaagctgctgtggccgcagactccgagaaa
tgttcacggattggacgggacattcttcggaaaggcggctctgcagtagatgctgccatt
gctgcgctgctgtgcacctccatcatcaacccacagtgtgcagggatcggaggcggggtc
atattcactgtgatggacagctctggtaaagtgaaaatcatcaactccagagagactgtc
cccagaaatgtgaaccctgacctgcttaagttgtgtcgtaaaaccacagagcagaccacg
gagtggctacaagatagcagatggattggggttcctggggaaattcgaggttatgaagcg
gcacaccggctttatgggaagttgccgtgggccgacctctttcagccgaccatcaaatta
gccagagaaggattccctattccttactaccaaggtcaacacatcccacgcattaataat
acgtcaatacggaagttatatttagataaaaatgggaacctgcttaagaccggggatact
gtgaaatttgagaaactggctgacactttggagatgatcgcaaacgagggaccagatgtg
ttttacaacggaacaatagcaaagaatttaatcagtgacattcaggatgcaggaggaaaa
ctcacactggaggacttggcattgtatcaagctaatgtgactgatgcttggaatatttct
ttggaagagtaccggatgtacttccctccgccccctgcagggggagccatactcagcctc
atcctcaacatcatgaaaggatacaaaatgaattcagaacctaagacgactgatgaaaag
attttgttttatcaccgttatattgaagctttaaaatttgccaatggattaaagaaacat
atcagagatccaaacttcagctcagataaaatggcaaagaatttgacagaggatagcttt
gccaaccacatacggagcttgatcagcagcgacaagactcacgatccccagtattacggc
aaaaactcatatctggacagcatcggcaccacacatgtatctgtgctggctgaagatgga
tctgctgtgtctgtcaccagcagcatcaatgatgaatttgggtccaatgtcctctcttca
agcactggaatcatcctcaacaaccacctaaatgacttctgtggtagagctgataacatc
tttcatggggagcggcctccctccaatatggccccttctgtgctgaagtctccgtcgaag
acgctggtgattggagggtctggtgctgaaatgattccaccggcagtggcctcggcgctc
atgaaccacctttggtttagaaagagccttaaggaggcaattgatactctagttgttctt
gtagactctaaaagtgaagtaaaacctgaacccaagcttgaaaaggatgtagttgatggt
cttgaagctaagggacataaaatagcaaaattctacaacacagttaatgctgtggaaaag
gcgggcagctgtatctctgcatggtctgatgaaaggaaaaaaggcaaagcagctggttac
tga

DBGET integrated database retrieval system