KEGG   Maylandia zebra (zebra mbuna): 101478990Help
Entry
101478990         CDS       T02814                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101478990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101478990
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101478990
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   101478990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo RIO1 APH FTA2 YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 101478990
NCBI-ProteinID: XP_004560359
Position
LG20
AA seq 487 aa AA seqDB search
MDVISDLTTGTCKVPDKVISPDLAELLAGESEQSSNRAKSLEFPGKAPADMGRQEADYVW
KKNTENIQEVFDFMEELGSGAFSEVYMVKEKKTGKNFAMKCVKKKQKRDLNLENEIAVLR
RIKHENVVGLEDFYESRTHYYLVMQLVSGGELFDRILDRGVYSEKDASRVIQQVLEAVSY
LHQNGIVHRDLKPENILYYSQEENSKIMISDFGLSKMVDNGIMSTACGTPGYVAPEVLAQ
KPYSNAVDCWSIGVITYILLCGYPPFYEESESRLFSKIMKAQYEFDSPFWDDISESAKDF
IRNMMQKNPKMRYTTDLALRHPWIIGKTARSQDIYYSVSVQIQKNFAKSKWKQAYNAAVA
INHMKKLQLAHSEQVLRQASIPDIRVIDVSSPTKNRKHLDPDKVEPKVPEVNGSVQGTHH
MSLLTSHVELKSHCHPLKTSQSHCSAQHAPTIAEQGKHVYHSEPANLNGYGKKNNNSKTI
TGVCAIM
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaatctccgacttaacaacaggtacttgtaaggtcccagataaagtaatctcc
ccagacctcgctgagcttttggcaggagagtcagagcagagctccaaccgcgcaaagtct
ctagaattccctggcaaagcacctgcagacatgggtcgtcaagaggccgactatgtgtgg
aagaagaacactgaaaacatccaagaggtttttgacttcatggaagagttgggatctggg
gcattctcagaagtttacatggtgaaggagaagaagacgggaaaaaatttcgccatgaag
tgtgtgaaaaagaaacagaagagggatctgaatctggagaatgagatcgctgtgctgcga
agaattaaacatgagaacgttgtggggctggaggatttctatgaaagtcgaacacattac
tatcttgtcatgcagctggtttcaggcggtgagctatttgaccgtatcctggatcggggg
gtgtactcagagaaggatgccagcagagtgattcagcaggtgctggaggccgtcagctat
ctgcaccaaaacggaatagtgcatcgggacctgaagcccgagaacatcctgtactacagc
caggaggaaaactccaagatcatgatcagtgatttcggcctgtcgaagatggtagacaat
ggcatcatgtcgacagcctgtggcaccccaggatatgttgctcctgaagttttggcacag
aagccctacagcaacgccgttgactgctggtctatcggagtcatcacctacatcctactt
tgcggttatccccctttttatgaagaaagtgagtcacggctcttctccaagatcatgaag
gcacagtatgagtttgactcaccattctgggacgacatctctgaatccgccaaggatttt
attcgtaacatgatgcagaagaatcccaagatgcgctacactacagacctagcgctcaga
catccatggattattgggaagacagctcggagccaggacatctactattccgtcagcgtt
cagattcaaaagaactttgccaagtccaagtggaagcaagcctacaatgctgctgttgcc
atcaaccacatgaagaagctgcagctggcccactcagagcaggtcctgaggcaggccagc
atcccagacatcagggtcatcgacgtgtcctccccaacgaaaaaccggaaacatcttgat
ccagacaaggttgagcccaaggtgccagaggtcaacgggagtgtgcaggggacacatcac
atgtccttgctcacaagccatgttgaactaaagagccactgccacccactgaagaccagt
cagagccattgcagtgcacaacacgcacctacaatagctgaacagggaaagcatgtgtac
cactcagagcctgccaacctgaatggatacggtaaaaaaaacaataatagcaagaccata
actggtgtttgcgccatcatgtga

DBGET integrated database retrieval system