KEGG   Maylandia zebra (zebra mbuna): 101479062Help
Entry
101479062         CDS       T02814                                 

Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00760  Nicotinate and nicotinamide metabolism
mze01100  Metabolic pathways
mze04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    101479062
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101479062
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mze04090]
    101479062
   00536 Glycosaminoglycan binding proteins [BR:mze00536]
    101479062
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     101479062
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     101479062
CD molecules [BR:mze04090]
 Proteins
  101479062
Glycosaminoglycan binding proteins [BR:mze00536]
 Hyaluronan
  Cell surface receptors
   101479062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse Herpes_US9 SP_C-Propep SNARE DUF3357 Sigma_reg_N EphA2_TM DUF929 DUF515 DUF3139 DUF1345 Baculo_11_kDa DUF3827
Motif
Other DBs
NCBI-GeneID: 101479062
NCBI-ProteinID: XP_014269579
Position
LG9
AA seq 276 aa AA seqDB search
MEHEQSRRLGKRRRKRCVILIVIVVLIVIVIIAVVLGLTLRQNKSEFESTFLSRCEKFNQ
YDCKKLWGVFQQAYVDKDPCKVLVEAYNPLIAAAPFKPQCNKTMFWSKTKDVVHGFTDKR
KDCFVTLEDTLLGSVLDGLTWCGKEGSKDTFTSGCPGWSECENNPVRSFWICASAAFADV
ACGDVTAMLNGSINTPFNPTSIFASVEVPRFNASRVKKLNVVMVIQKNNISNCNHSSLKN
LTQALDTGITYSCKDVSESRIQECGAKPEIACGACW
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggagcacgagcagtctcgtcgactagggaaacggcggaggaaacgctgcgtaatatta
attgtcatcgttgtccttattgttattgtaatcatcgccgtggtgttgggactgactctc
cgtcagaacaaaagtgaatttgaatctacatttttgtctaggtgtgagaagttcaatcaa
tatgactgtaaaaagctgtggggtgtctttcagcaggcctatgtggacaaggatccatgt
aaagttctagtggaagcttataatcccctgattgctgcagcccccttcaaacctcagtgc
aacaaaacgatgttctggagcaaaacaaaggatgtggtccatggtttcactgacaagaga
aaggattgttttgtcactttggaggacactctgttgggatctgtcctggatggtctgacc
tggtgtggaaaagaaggcagcaaggataccttcactagtgggtgtcccggatggtcagag
tgtgaaaacaaccctgttcgctcattttggatttgtgcctctgctgcttttgcagatgtt
gcctgtggtgatgtcacagcaatgttaaacggatccatcaacacaccattcaatcctaca
agtatttttgcaagcgttgaggtgccgaggtttaatgcctctagggtcaagaagctgaat
gttgttatggtcatacagaagaacaacatatcaaactgtaatcattcatccttgaagaat
ttgacgcaagcgctagatacagggataacatacagctgcaaagacgtgtctgaatctcgg
attcaggaatgtggtgccaaaccagagatagcgtgtggagcctgctggtga

DBGET integrated database retrieval system