KEGG   Maylandia zebra (zebra mbuna): 101479229Help
Entry
101479229         CDS       T02814                                 

Definition
(RefSeq) TGF-beta receptor type-1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04060  Cytokine-cytokine receptor interaction
mze04068  FoxO signaling pathway
mze04144  Endocytosis
mze04218  Cellular senescence
mze04350  TGF-beta signaling pathway
mze04371  Apelin signaling pathway
mze04520  Adherens junction
mze04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101479229
   04350 TGF-beta signaling pathway
    101479229
   04371 Apelin signaling pathway
    101479229
   04068 FoxO signaling pathway
    101479229
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101479229
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101479229
  09143 Cell growth and death
   04218 Cellular senescence
    101479229
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101479229
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101479229
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101479229
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101479229
Protein kinases [BR:mze01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   101479229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 101479229
NCBI-ProteinID: XP_004572123
Position
Unknown
AA seq 503 aa AA seqDB search
MGAVRLFVVVLLFGTRIQENNGLQCYCDRCSTNSSCTTDGICFVAIQKSGSRMTIEQRQC
VHNRDLIPRDRPFICAPSTKDDSGIYPLCCTTDYCNKEPVTPTGPTATPSPLGAVALAAV
IAGPVCVLCLLLVLAFYVCHSHRGLGAGGAGAHHHHRVPNEEDPSMDHPFITVGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIILQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLSLSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIASRCSMGGI
HEDYQLPYYDLVQSDPSVEEMRRVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcagtacggctttttgtggtcgtccttctttttgggacaaggatacaagaaaat
aatggccttcagtgttactgtgaccgctgcagcaccaactccagctgcacgacagacggt
atctgctttgtagccatccaaaagtcaggcagccggatgaccattgagcagcgccagtgt
gtgcacaatcgtgacttgatcccacgagaccgacccttcatctgtgccccatctaccaaa
gatgacagtggcatttacccactgtgctgtaccacagactactgcaacaaagagccagtg
acccccactggccccacagcgaccccttctcctctgggggcggtggccctcgctgctgtc
attgctggccctgtatgtgtcctctgcttgctgctggttttggcgttctacgtttgccac
agccacagaggcctgggcgccgggggagccggggcccaccaccaccatcgggtgcctaat
gaggaagacccctccatggaccaccctttcatcactgtgggaacaacactgaaggaccta
atctatgacatgaccacttcaggctctggatcaggtctcccactgctggtccaaagaaca
attgccagaactatcatcctccaggaaagcattgggaaggggcgttttggtgaggtgtgg
cgcggcaaatggcgcggcgaggaggtggctgtcaagattttctcttcccgagaggagcgc
tcctggttccgtgaggctgagatctaccagactgtgatgctgagacatgagaatatcctg
ggcttcattgctgctgacaacaaagataatggaacgtggactcagctgtggctggtgtcg
gactaccatgagcacggatcgctgttcgactacctgaaccgctacacggtcacagtggag
ggcatgatcaaactgtctctgtcaacagccagcggcctcgcccaccttcacatggagatc
gttggcacgcaagggaagccagctattgcccacagagacctgaagtccaagaacatcctg
gtgaagaaaaacgggacatgctgcatcgctgacctgggtctggctgtgcggcacgactcc
gccaccgacaccatcgacatcgctccgaaccacagagtagggaccaaaaggtatatggct
ccagaggttctggacgactccataaacatgaagcattttgagtctttcaaacgagctgac
atctacgccatgggcctcgtcttctgggagattgccagtcgctgctccatgggaggcatt
cacgaggactaccagctgccctactacgacctggtccagtcagatccatcagtggaggag
atgagaagggtggtttgtgagcagaagcttcggcccaacatccccaaccgctggcagagc
tgtgaggccttacgggtgatggcaaagatcatgagggagtgctggtacgccaacggagct
gcacgactcactgctctgcgaatcaagaaaacgctgtctcagctcagccaacaggagggg
atcaagatgtag

DBGET integrated database retrieval system