KEGG   Maylandia zebra (zebra mbuna): 101479522
Entry
101479522         CDS       T02814                                 

Gene name
asic1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mze04040]
    101479522 (asic1)
Ion channels [BR:mze04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   101479522 (asic1)
SSDB
Motif
Pfam: ASC T4-gp15_tss
Other DBs
NCBI-GeneID: 101479522
NCBI-ProteinID: XP_004547676
UniProt: A0A3P9B6P0
Position
LG5
AA seq 560 aa
MPLRIMCTISFSADDEPSRGYGSDGFDDHYKRVKKHYSDGDSQECLDRCSQVDDCTDEED
NVSDVDDLATFFGNCSLHGANHVFVEDSKFGFRQGLWALVFTLALSAFMYQVVDRVIYYF
QYDYITMLDEKVANNMTFPAVTVCNYNFIRKSQMSYSDLIFMGPLLGFEEGMAPGFPLAP
EPDRPLGSRFSMDEFYNRTRHRMEEMLLECNFRGIECGPDSFTEIFTRYGKCYTFNSGKD
GKPLQVTTKGGMGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQDEPPFIDQLG
FGVAPGFQTFVSCQEQRLTYLPPPWGDCKSTPMDSDFFSSYSITACRIDCETRYLVDNCN
CRMVHMPGNAPYCTPEQYKECADPALDFLVEKDNDFCVCETPCNLTRYGKELSFVKIPSK
ASAKYLAKKYNKTEQYIADNILVLDIYFEALNYETIEQKKAYELAGLLGDIGGQMGLFIG
ASILTILELIDYLYEVIKYKVCRCMKKKHKGRKNNDRGAVLSLDDVKHHAPCENLRTPST
YPGNMLPHHPGQGNFEDFTC
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgccactccgaattatgtgcaccatctccttttctgctgatgacgaacctagcagggga
tatggtagcgatggttttgacgaccactacaagcgggtaaagaaacattatagtgatgga
gactcacaggaatgcctggataggtgtagtcaggtagatgattgcactgatgaggaggat
aatgttagcgatgtagatgacctcgccactttttttggcaattgctcgcttcacggagct
aaccacgtgtttgtagaggacagtaagtttggttttcgccagggtttgtgggcactggtc
ttcaccttagcactgtctgctttcatgtatcaagtagttgacagggttatatactacttc
caatatgattatattacaatgcttgacgaaaaagtggcaaacaatatgacctttcccgct
gtaactgtatgtaactacaacttcatacgaaagtctcaaatgagctacagtgacctgatc
tttatgggtcctcttctgggctttgaagaaggcatggcaccaggatttcccctggctcca
gagccagaccgcccgctgggctctcgcttcagtatggatgagttctacaaccgcactcga
catcgcatggaggaaatgctactggagtgtaacttcagaggtatagaatgcggccccgac
agcttcacagagatattcacgcgctatgggaaatgctacacatttaattcaggcaaagat
ggaaaaccgctgcaggtgacgacgaagggtgggatgggcaatggcctggagctgatgttg
gatatccagcaggatgaatacttgcctgtctggggagagactgatgagacatcgtttgaa
gcagggatcaaagttcagatccacacccaagatgagccgccgttcatagaccagctgggc
ttcggagtggcgccggggtttcagacgtttgtctcctgtcaggaacaacggctgacatac
ctgcctccaccatggggcgactgcaaatccacaccgatggattctgactttttcagcagt
tacagcatcacggcctgcaggatcgactgtgaaacacgatacttggtggataactgtaac
tgtaggatggttcatatgcccggaaatgccccatactgcaccccggagcagtacaaggag
tgtgcagatcctgccttggactttcttgtcgagaaagacaatgacttttgtgtgtgtgag
acgccgtgcaacttaacacgttatggtaaagagctgtcctttgtcaagatacccagcaaa
gcatcggccaagtaccttgccaagaaatataacaaaactgagcagtacatagctgataac
attctggttttggatatctactttgaagcgctgaactacgaaaccatcgaacaaaagaaa
gcctatgaattggcaggccttctgggtgatattggtggtcagatgggtctcttcattggg
gccagcatcctcaccattcttgaactcattgactatctatatgaggtgatcaaatacaag
gtgtgccggtgcatgaagaagaaacacaaaggccgcaaaaacaatgaccggggagctgtg
ctgagcctggatgatgtgaaacaccatgctccttgtgagaacctgcgtacaccatcaacg
tatcctggcaatatgctacctcatcatccaggccagggtaactttgaagacttcacttgc
tga

DBGET integrated database retrieval system