KEGG   Maylandia zebra (zebra mbuna): 101479970
Entry
101479970         CDS       T02814                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04080  Neuroactive ligand-receptor interaction
mze04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101479970 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101479970 (apln)
SSDB
Motif
Pfam: Apelin TMEM65
Other DBs
NCBI-GeneID: 101479970
NCBI-ProteinID: XP_004545802
Position
LG2
AA seq 77 aa
MNVKILTLVIVLLVSLLCSASAGPMASTVHGRELQDASMVRKMVQQNSARGGQTHRPTSS
KRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
agtgctggtcccatggcctccacggtgcatggcagagagctgcaagatgcatctatggtg
agaaaaatggtccagcaaaactctgcaaggggcggtcagacccacagaccaaccagctcg
aagagaagacgcccacggccccgtctttcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system