KEGG   Maylandia zebra (zebra mbuna): 101480171Help
Entry
101480171         CDS       T02814                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform isoform X2
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00071  Fatty acid degradation
mze01212  Fatty acid metabolism
mze03320  PPAR signaling pathway
mze04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101480171
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101480171
   03320 PPAR signaling pathway
    101480171
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mze03029]
    101480171
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     101480171
Mitochondrial biogenesis [BR:mze03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101480171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 101480171
NCBI-ProteinID: XP_004570373
Position
Unknown
AA seq 692 aa AA seqDB search
MSLSAQGQTMVSALVFSTLLWLSLILALRFCLKLLLSYHQWMFEKHGRMSNTTKVWVPLV
RLLSSRKPLLYSYQSSLPHLPVPAIQDTVSRYLESVRPLLTDPEFKRMSDLANEFESNLG
NRLQRYLKLKALWATNYVSDWWEEYVYLRSRGPIMVNSNYYGMDFLYVTPTSVQAARAGN
TITALLLYRRKVNREELKPSRVPGTVIPLCAAQCERMFNTTRTPGVETDVLQHWLDSEFV
AVYHRGRYFRLWVYRAGRLLSPREIEDQIQRILDDASPPLPGEEKLGALTAGDRIPWAQM
RKQYFSSGVNKRSLDIIERAAFFVTLDDEEQGMRGDDPEGNLDRYAKSLLHGKCYDRWFD
KSFSVVIYKNGKSGLNAEHSWADAPTVAHLWEYTLATDAFQLGYTEDGHCKGDVEPSLPQ
PQRLVWNIPAEVQAQVSSSLAVAQALADDVDCHVFPFREFGKGRIKKCRVSPDAFIQISL
QLAYYRDRGGFCLTYEASMTRLFREGRTETVRSCSNESCAFITALESGETEEECRRLFQL
ASERHQNLYRMAMTGAGIDRHLFCLYVVSKYLGVESPFLKEVLSEPWRLSTSQTPVQQMN
LFDLKNHPDFISLGGGFGPVADDGYGVSYIIVGEDMVNFHVSSKYSCSQTDSHRFGVQIS
KAMQDIMALLSADPKTSLSSKGTGQPQSKKLQ
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcagtgcccagggccagactatggtgtcagcgctggtcttcagcactctgctg
tggctctccctcatcctcgccctcaggttctgcctcaaactgctgctgtcctaccaccag
tggatgtttgaaaagcacggccggatgtctaacaccaccaaagtctgggtgcctctggtg
aggttgctgtcaagcaggaagcctttgctgtacagctatcagtcgtctctacctcacctc
cccgttccagccatccaagacaccgtgagcaggtacttggagtcggtgcgccctctgctg
acggacccggagtttaaacgcatgtcagacctggccaatgagtttgagtcgaatctgggg
aaccgcctccaacgctacctgaaacttaaagctctgtgggccaccaattatgtgagtgac
tggtgggaggaatacgtctatttaaggagccgaggtcccataatggtcaacagtaactac
tatggaatggattttctgtacgtgacaccaacctcagtgcaggcggccagggcagggaac
acgatcactgccctgctgctctaccgccgcaaggtgaaccgggaggaactgaagccgagc
cgcgttccgggtaccgtcatccccctgtgtgctgctcagtgtgagaggatgttcaacaca
acgcgcacaccaggagtcgagactgatgtgctccagcactggctagacagcgagtttgta
gcagtgtaccacagggggcgctattttcgcctgtgggtgtaccgggcaggccgcctgctg
tcccccagggagattgaagaccagatccagagaatcctggatgacgcttcacccccgctt
cctggagaggagaagctgggagctctcactgctggagacagaatcccttgggctcagatg
aggaagcagtacttcagctctggggtcaacaagagatcgctggatatcattgagagggcg
gccttctttgtaaccttggatgacgaggagcaaggcatgaggggagatgacccagagggg
aacttggaccgctacgccaagtctctgcttcatgggaaatgttatgacaggtggtttgat
aaatccttctccgttgtgatctacaagaatgggaagagtgggctgaatgcagagcactcc
tgggctgatgcaccaactgtagcgcacctttgggagtacacgctggccacagatgccttc
cagctaggctacaccgaggacggccactgtaaaggtgatgtggagccttctctaccccaa
cctcagagacttgtctggaacatcccggcagaggttcaggctcaggtcagcagctctcta
gctgttgcacaggcgctggcagatgatgtcgactgtcatgtgtttccattcagagagttt
ggcaaaggacgaatcaagaaatgccgagtcagcccagacgccttcatccagatcagctta
caactggcatactacagggatcgcggtggcttttgtctgacttacgaggcatcgatgacc
cgtctgttcagagagggccggacagagactgtgcgctcctgctccaacgagagctgtgct
ttcatcacagctctggagagtggagagacagaggaggaatgcagacgccttttccaactg
gcttctgagaggcaccagaacctttatcggatggctatgactggagcaggaatcgacaga
catctcttctgcctttacgtagtctccaaatacttgggagtggagtcgcctttcctcaaa
gaagttctgtctgagccttggcgtctctccaccagtcagactccagttcagcagatgaat
ctgttcgacctgaagaaccacccagatttcatctcgcttggtgggggctttggacctgtt
gctgacgatggttatggagtttcatacatcatcgtgggtgaagatatggtcaacttccac
gtgtcttccaaatactcctgcagtcagactgactctcacaggtttggagttcagataagt
aaggctatgcaggacatcatggctcttctctcagctgatcccaaaacctccttgtcatcc
aaaggcacaggccagccacagtccaagaagctccagtaa

DBGET integrated database retrieval system