KEGG   Maylandia zebra (zebra mbuna): 101480373Help
Entry
101480373         CDS       T02814                                 

Gene name
hsd17b8
Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00061  Fatty acid biosynthesis
mze00140  Steroid hormone biosynthesis
mze01100  Metabolic pathways
mze01212  Fatty acid metabolism
Module
mze_M00873  Fatty acid biosynthesis in mitochondria, animals
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101480373 (hsd17b8)
   00140 Steroid hormone biosynthesis
    101480373 (hsd17b8)
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     101480373 (hsd17b8)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     101480373 (hsd17b8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Epimerase 3HCDH_N 3Beta_HSD RmlD_sub_bind F420_oxidored TrkA_N GDP_Man_Dehyd 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 101480373
NCBI-ProteinID: XP_014269251
Position
LG22
AA seq 256 aa AA seqDB search
MAAATRLISRLTLVTGGGSGIGRAVCQRLASEGASVVVADISEESANETLGSLQSNLRGQ
VHTAAVVDVSSKESIKKLVMSVQTRYFQPPSVCVNAAGITQDDFLLNMEEEQFDKVIQIN
LKGSFLITQAVAQALVACGAPKGSIITVGSIVGKVGNIGQANYAASKAGVEGLTRTAAKE
LSRFGIRCNCVLPGFITTPMTDKVPEKVISKIESLVPLGRMGEPAEVADVCAFLASDDSQ
YITGASIEVTGGLFMG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgccacaaggctcatctcaaggttgacgctggtcaccggtggaggcagtggg
atcgggcgggcggtgtgccagcgtttggcctctgagggcgcctccgtggtggtcgctgac
atcagcgaggagtcggccaatgagacgctggggagtctgcagagcaacctcagagggcag
gtccacacggcggctgtagtggacgtgtcgtctaaagagagcatcaagaagctggtaatg
agcgtgcagactcggtacttccagcctccctcggtgtgcgtgaacgcagccggcatcact
caggatgacttcctgctcaacatggaggaggagcagtttgataaagtcatccagatcaac
ctgaagggttcattcttgatcactcaggcggtcgctcaggctctggtggcctgtggagcg
cccaaaggatccatcattactgtgggcagcatcgtgggaaaggtaggaaacatcggtcag
gctaactacgctgcctctaaagctggagtcgagggtttaacaaggaccgctgccaaagag
ctcagcaggtttgggattcgctgtaactgcgtgctgccagggttcattacgactccaatg
acagataaagtgccagagaaggttattagcaagatcgagtccttggtgcctctgggaagg
atgggcgagccggcggaggtcgctgatgtctgcgccttcctcgcctcggacgactctcag
tacatcaccggagccagcatcgaagtgacaggcggacttttcatgggttaa

DBGET integrated database retrieval system