KEGG   Maylandia zebra (zebra mbuna): 101480703Help
Entry
101480703         CDS       T02814                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze03040  Spliceosome
mze04010  MAPK signaling pathway
mze04141  Protein processing in endoplasmic reticulum
mze04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101480703
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101480703
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101480703
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101480703
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mze01009]
    101480703
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mze03041]
    101480703
   03009 Ribosome biogenesis [BR:mze03009]
    101480703
   03110 Chaperones and folding catalysts [BR:mze03110]
    101480703
   04131 Membrane trafficking [BR:mze04131]
    101480703
   03051 Proteasome [BR:mze03051]
    101480703
   03029 Mitochondrial biogenesis [BR:mze03029]
    101480703
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mze04147]
    101480703
Protein phosphatases and associated proteins [BR:mze01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101480703
Spliceosome [BR:mze03041]
 Complex B
  Other components
   Prp19 complex
    101480703
 Complex C
   Prp19-CDC5 complex
    101480703
Ribosome biogenesis [BR:mze03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    101480703
Chaperones and folding catalysts [BR:mze03110]
 Heat shock proteins
  HSP70 / DNAK
   101480703
Membrane trafficking [BR:mze04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    101480703
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101480703
Proteasome [BR:mze03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101480703
Mitochondrial biogenesis [BR:mze03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    101480703
Exosome [BR:mze04147]
 Exosomal proteins
  Proteins found in most exosomes
   101480703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C CRIC_ras_sig DDR Ppx-GppA
Motif
Other DBs
NCBI-GeneID: 101480703
NCBI-ProteinID: XP_004558171
UniProt: A0A3P9B9R0
Position
LG14
AA seq 646 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPNNTIFDAKRLIGRRFDDSVVQSDMKHWPFTVINDASRPKVKVEYKGEAKTFYPEEIS
SMVLLKMKEIAEAYLGKTVTSVVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA
IAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLEPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRQKVSAKN
GLESYAFNMKSAVEDEKLKGKISDEDKQKILDKCNEVISWLDRNQTAEKDEFEHQQKELE
KLCNPIMTKLYQSAGGVPGGMPGGFPGGGAAPGGGGSSGPTIEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagggaccagcagttggtattgacctgggcactacctactcctgtgtaggagtt
tttcagcatggcaaagtggaaatcattgccaatgaccagggaaacaggactacacccagc
tatgttgcattcactgacacagagaggctgattggggatgcagccaagaaccaagtggcc
ttgaacccaaacaacacaatatttgatgccaaacgtctcattggacgccggtttgatgac
agcgttgtccagtcagacatgaaacattggccctttacagtgatcaatgatgcttcacgg
cccaaagtaaaggtggaatacaagggtgaggccaagacgttttacccagaggagatctcc
tccatggtgctgcttaaaatgaaggagattgcagaagcataccttggcaagacggtaaca
agtgtcgtagtgactgtgcctgcctacttcaacgactctcagcgccaggccaccaaagat
gcagggaccatttctgggcttaatgtccttcgtatcatcaatgagcccaccgctgctgcc
attgcctatggcctggacaaaaaggttggatcagagagaaatgttctcatcttcgatctg
ggcggcggcacatttgacgtctcgatcctgacaattgaagacggcatctttgaagtgaag
tccacagcgggtgacactcacttgggcggtgaagactttgacaaccgcatggtgaaccac
ttcatctccgagttcaaacgcaagtacaaaaaagacattagcgacaacaagagggcggtg
cgtcgtctgcgcacggcatgtgagagggccaagcgcaccctgtcatccagcactcaggct
agcattgaaattgactctctgtacgagggcatcgatttctacacctccatcaccagagcc
cggtttgaggagctgaacgcagatctgttccgaggaaccctggagcctgtggaaaaggct
ctccgtgatgccaagatggataaggcccaaatccatgacattgtgctagtggggggttct
actcgtattcctaagatccagaagctcttgcaagatttcttcaatgggaaggaactcaat
aagagcattaaccctgatgaggcagtggcctacggtgcagctgtgcaggcagccatcttg
gcaggtgacaaatctgagaatgtgcaggatctcctgctgctggatgtgacccccttgtct
ctgggcatcgagactgctggaggagtcatgactgtgctgatcaagagaaacaccacaatc
cccacaaagcagacccaaacctttaccacctattcagacaaccagcctggtgtgctcatt
caggtgtttgagggtgaaagagcgatgacaaaagacaacaacctcttggggaaatttgag
ctcaccggaatcccgccagccccacgtggggttccacagattgaggtgacattcgatatc
gacgccaacggcattatgaatgtgtctgcagtcgacaagagcaccggcaaggagaacaag
atcacaatcaccaatgacaaaggtcgcttgagcaaagaggacatcgagcgcatggtccag
gaagctgagaagtacaaagctgaggacgacgtgcaaagacagaaggtctctgccaagaac
ggtctggagtcttatgccttcaacatgaagtccgctgtggaggatgagaagctaaagggc
aagatcagcgacgaagacaaacagaagattttggataaatgtaacgaggtcatcagctgg
ctggatagaaaccagacggcagaaaaagatgagtttgaacatcagcagaaagagctggag
aagctgtgcaaccccatcatgaccaagctgtaccaaagtgcaggtggggttccagggggc
atgcccggcggcttccccgggggtggtgctgctcctggaggaggaggatcctccggcccc
accatcgaggaggtcgactaa

DBGET integrated database retrieval system