KEGG   Maylandia zebra (zebra mbuna): 101480888Help
Entry
101480888         CDS       T02814                                 

Gene name
pla2g4a
Definition
(RefSeq) cytosolic phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00564  Glycerophospholipid metabolism
mze00565  Ether lipid metabolism
mze00590  Arachidonic acid metabolism
mze00591  Linoleic acid metabolism
mze00592  alpha-Linolenic acid metabolism
mze01100  Metabolic pathways
mze04010  MAPK signaling pathway
mze04217  Necroptosis
mze04270  Vascular smooth muscle contraction
mze04370  VEGF signaling pathway
mze04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101480888 (pla2g4a)
   00565 Ether lipid metabolism
    101480888 (pla2g4a)
   00590 Arachidonic acid metabolism
    101480888 (pla2g4a)
   00591 Linoleic acid metabolism
    101480888 (pla2g4a)
   00592 alpha-Linolenic acid metabolism
    101480888 (pla2g4a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101480888 (pla2g4a)
   04370 VEGF signaling pathway
    101480888 (pla2g4a)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101480888 (pla2g4a)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101480888 (pla2g4a)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101480888 (pla2g4a)
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101480888 (pla2g4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 101480888
NCBI-ProteinID: XP_014262806
UniProt: A0A3P9CR94
Position
LG17
AA seq 745 aa AA seqDB search
MTMASNIIVEQQFSHKFTVTVVRAQNVTKGALGDLLDTPDPYVEIFIPTAPESRRRTKHI
DNDINPKWNETFHFILDPNQHNVLELTLMDANYVMDETLGTASFEISKLNVGQTKTEVFL
IGKATKVHLEMSLEICTNLDLRFSHTLCDKEKQFREARREKVMLGIKKLLRTEDPCHPEE
VPVIAIAGSGGGFRAMVGFSGVMKALFESGVLDCTTYIAGLSGSTWYMSTLYSNPDFPNK
GPKDINSELMKRVSSNPLRLLMPQHITHYIQALWTKKASGQPVTFADIFGMLIGETLIPS
RMGIKLSDIQEKINQAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGTFMTPD
LFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVKDRAGGSTMEEELEQIKPQ
HIVGEDTLDDDEPRKGGTENQEAEEEFHRTAQASWVQRMFTSVLGDSALFNTREGRAGKV
HNFMLGLNLNTNMPFSPLLEITHAMTPEEEVDAVTDPDEFDRIYEPLDVKSKKIHVVDSG
LTYNLPYPLILRSQRGVDLIISFDFSARPSDSSPPFKELLLAEKWARMNKLPFPKIDPKV
FDREGLKECYVFKPKSGEKNCPTVIHFVLVNINFRKFKAPGVARETEKEKELADFDIFDD
TETPYSTFNFQYSNEAFIQLHDLMEFNTLNNLEVIKEAIKDCIASRKDNPSSVSRPFNLS
EIPKKKILKRDHQGKPVNHLGNNSQ
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggcttccaatataattgtggagcagcagttttctcacaaattcacagtgact
gtagttcgagctcagaacgtcaccaagggagcgctgggcgacctgctggacactccagac
ccgtatgtggagattttcatcccgacggctcctgaaagcagaaggaggaccaagcacata
gacaacgacatcaatccaaaatggaacgagacctttcatttcatattagaccccaaccag
cacaacgttctggagttaacattaatggatgccaactacgtgatggatgagacgcttggg
acagcatcctttgaaatctccaaactcaatgtgggccagacaaagacggaggtgttcctc
attggcaaagcaaccaaagtgcacttagagatgtcactggagatctgtacaaacctggac
ctgcggttcagccacaccctttgtgacaaggagaagcaatttagagaagcccgtcgagaa
aaggtgatgctcggcatcaagaagctgctacgcactgaggatccttgtcacccagaagag
gtgccagtgatagccatagccgggtcaggaggcggtttccgcgccatggtggggttttcg
ggcgttatgaaggccctgtttgagtccggggtcctcgactgtaccacatatattgctggc
ctctctggatccacatggtacatgtcaactctctactccaaccctgactttccaaataag
ggcccgaaggacatcaacagtgagttgatgaagagagttagcagtaacccacttaggctg
ttgatgccccagcacatcacccactatatccaggccctgtggaccaaaaaggcttcagga
cagccggttacttttgcagatatctttggtatgctcataggagagacacttataccctcg
agaatgggcatcaagctaagcgacatccaggagaaaataaaccaagcccagtgtccgctt
cctcttttcacatgtctgcatgtcaaaccggatgtttctgagctcatgtttgcagactgg
gtggagtttagcccgtatgaaattgggatggcaaagtatggcaccttcatgacccctgac
ctatttggaagcaagttcttcatgggaactgttgtgaagaagtacgaggaaaaccctctt
cattttctgatgggtgtgtggggaagtgccttctcaattctgttcaacagagtgctaggg
gtcaaggacagagctggtggcagcaccatggaggaggagttagagcagatcaaaccacag
cacatcgttggagaagacaccctggacgacgacgagccacgcaaaggtgggacagaaaac
caggaggcagaggaggagtttcatcgcaccgctcaggccagctgggttcagcgtatgttc
acgtcagtcttgggcgactctgctttgttcaacacaagggagggtcgtgctggaaaggtg
cataacttcatgttgggcctgaacctgaacaccaacatgccattctctccattacttgag
ataacacacgctatgacacctgaagaggaggtggatgctgtcacagatcccgatgagttc
gatcgaatctacgagcctctggatgtgaagagcaagaagatccacgtagtagacagcggc
ctgacctacaaccttccctacccccttatcctgcgctcgcagcgcggcgtcgacctcatc
atctcctttgacttttcagctcgaccgagtgactcaagccctccgttcaaggagcttctc
ctcgctgagaaatgggctagaatgaacaagctgccattccccaagatcgaccccaaagtc
tttgaccgtgaaggtctgaaggaatgctacgtcttcaaaccaaagagcggtgaaaagaac
tgcccgacggtcatccactttgtcctcgtcaacatcaacttcaggaaattcaaagcgcct
ggcgttgccagggagactgagaaggagaaggagctggccgattttgacatttttgacgac
accgagacaccatactccaccttcaacttccaatactccaacgaagctttcatccagctt
catgacctgatggagttcaacactctcaacaacctggaggttattaaagaagccatcaag
gactgcatcgcgtctcgtaaggacaatccctcgagcgtctctcgtcctttcaacctcagt
gagatcccaaaaaagaagattctcaaacgagatcatcaaggaaagcctgtgaatcacctt
gggaataatagccagtag

DBGET integrated database retrieval system