KEGG   Maylandia zebra (zebra mbuna): 101481430
Entry
101481430         CDS       T02814                                 

Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101481430
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     101481430
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 101481430
NCBI-ProteinID: XP_004547683
UniProt: A0A3P9B387
Position
Unknown
AA seq 332 aa
MDTQFVYDLLGENAWLYISATFIVLWIVGWLYRDSLEIEDFKNKYVFVTGCDTGFGNLLC
KKLDRKGFRVLAGCLTEKGADDLKRVAGPYLKTVLLDVTSQDSIEKAMEWTKQEVGDKGL
WGLVNNAGRSLPMGPSEWMKVEDFHSTLKVNMNGVIAMTMTFLPLIKQARGRIVNVASVL
GRVAANGGGYCISKFAVESFSDCLRRDIHYFGIKVCIVEPGFFKTAVTSLEPIERELHRL
WNQLSPEVKASYGDKYLDKYVNIQRLIMNAVCDSDLTKVTNCMEHALSAAYPRTRYSAGW
DAKLVWIPLSYMPSFVVDIALKLVLPRPSKSV
NT seq 999 nt   +upstreamnt  +downstreamnt
atggatacacagtttgtgtatgaccttttaggggaaaatgcttggttatacatttctgct
accttcattgtgttgtggattgtcgggtggctctacagagacagcttggagattgaggat
ttcaaaaataagtatgtctttgttactggctgtgacacggggtttggaaacctgctgtgt
aagaaactggatcgtaaaggtttccgtgtactagctggctgtctcacagaaaagggagct
gatgatctgaaaagagtggcagggccttatctgaagactgtcctgctggatgtgaccagt
caggatagcattgaaaaagcaatggagtggaccaagcaagaggttggcgataagggactt
tggggtcttgtgaacaatgctggacgttcattacccatgggtccatccgagtggatgaaa
gtggaggatttccacagcacactgaaagtaaacatgaatggagtgattgccatgacaatg
accttcctgcccctcatcaaacaggctcgtggtcgtattgtaaatgtagcatcagtgctt
ggtagagtggcagcaaatggtggtggatactgcatttccaagtttgcagtagaatctttc
tctgactgcctcaggagagacatccactactttggaattaaggtatgtatcgttgagcct
gggtttttcaagactgcagtaacgagcctcgaacccattgagagggagctccatcgcctg
tggaaccaactcagccctgaagtaaaggccagctatggagacaaataccttgataaatat
gtcaatatacagcgtttgatcatgaatgccgtctgcgactctgacctcactaaagtgacc
aactgcatggagcacgctctctctgctgcctaccctcgcaccagatacagtgctggctgg
gatgccaagcttgtctggatccccctctcttacatgccttcctttgtagttgatattgca
ctgaagctcgtgcttccacgtccttcaaagagcgtctga

DBGET integrated database retrieval system