KEGG   Maylandia zebra (zebra mbuna): 101481779Help
Entry
101481779         CDS       T02814                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00232  Caffeine metabolism
mze00983  Drug metabolism - other enzymes
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    101481779
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101481779
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     101481779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 101481779
NCBI-ProteinID: XP_004539759
UniProt: A0A3P9BDV0
Position
LG1
AA seq 290 aa AA seqDB search
MNLEEYFKRIGFHGSYDKLDLATLKLIHRQHIMSIPFENLSIHCGEKIIMDLEVIFNKVV
RGTRGGWCFENNYLFSWVLRQMGYDTTTLGSRVFDTSINDFESQEVHLINKVIIEGKAYI
ADVSFGLSGQIREPLELISGKEQPQDGGVFRFICKDNLWMLEKTGRRTEVPNPEFAKSSL
VNRKETRLIHCFSLEPREPDHFFQVNNDLQTDPTSLFTNKSICSLQTPTGFTALVGLIYS
EVIFKPDEGVDLYNMKNITEDELEAVLMEKFKVKLQNKMQAVNRRVVLEF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaatttggaagagtacttcaaaagaattggtttccatggctcctatgataaactggac
cttgcaacactgaagctgatccacaggcagcacattatgtccattccatttgagaacctc
agcatccactgtggagagaaaataatcatggaccttgaggttatcttcaataaggttgtg
aggggtacccgtggaggttggtgctttgagaacaactacctgtttagctgggtgctgaga
caaatgggctatgacactacaaccttgggctccagagttttcgacacgagcattaatgac
tttgaatcccaggaagtacatctcattaacaaggtcatcattgaggggaaggcttatata
gcagatgtaagttttggattatctggccaaatacgggagcccctcgagctcatctctgga
aaggaacagcctcaggatggaggcgtctttcgcttcatatgcaaggacaatttgtggatg
ctggagaagactggcagaagaacggaggttcctaacccagaatttgctaaatcaagtctg
gtcaaccggaaggagacgcgactgatccactgcttcagcttggagcctcgtgagccagat
catttctttcaagtgaacaatgacctccagacagaccccacctcactgttcaccaacaag
tccatctgctctttgcagacgcccacaggattcacagcgctggttggcttgatctacagt
gaggtcatatttaagccagatgaaggtgttgatctctataacatgaaaaacataacagaa
gatgaactagaggctgtgctgatggagaagttcaaagtgaagctgcagaacaaaatgcag
gctgtaaacagaagagtagtccttgaattttag

DBGET integrated database retrieval system